| IED ID | IndEnz0002005471 |
| Enzyme Type ID | protease005471 |
| Protein Name |
Derlin-1 DER1-like protein 1 |
| Gene Name | Der-1 CG10908 |
| Organism | Drosophila melanogaster (Fruit fly) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly) |
| Enzyme Sequence | MDAGVWYRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTSLFVFPISSNTAFHFLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFLMDTLVLAITYIWCQLNKDVTVSFWFGTRFKAMYLPWVLAAFEFIFHFSLASLVGIFVGHVYYFFKFQYSQDLGGTPLLETPQFLKRLVPDVSGGFGGFGLPPESRAPPRQATESPWGRGMTLGRN |
| Enzyme Length | 245 |
| Uniprot Accession Number | Q9VQ57 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins. May also involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation. {ECO:0000250|UniProtKB:Q9BUN8}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Region (1); Topological domain (5); Transmembrane (4) |
| Keywords | Endoplasmic reticulum;Membrane;Reference proteome;Stress response;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: By endoplasmic reticulum stress. |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q9BUN8}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q9BUN8}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14602076; 15616571; 18791253; 19805114; 20220848; 20371351; 21074052; 23071443; 24281154; 25255315; 25903460; 26290570; 26551273; 28633019; 30893296; 32525804; 34253734; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,256 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |