| IED ID | IndEnz0002005506 |
| Enzyme Type ID | protease005506 |
| Protein Name |
Beta-crystallin B1 Beta-B1 crystallin Cleaved into: Beta-crystallin B1B |
| Gene Name | Crybb1 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MSQAAKASATTAVNPGPDGKGKGAPSTGPAPAPGPTPVPASVPRPAAKVGDLPPGSYRLIVFEQENFQGRRVEFSGECLNLGDRGFDRVRSLIVVSGPWVAFEQSAFRGEMFVLEKGEYPRWDTWTSSYRSDRLMSFRPIRMDSQEHKICLFEGANFKGNTMEIQEDDVPSLWVYGFCDRVGSITVSGGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQAVRRLRDRQWHQEGCFPVLTAEPPK |
| Enzyme Length | 250 |
| Uniprot Accession Number | Q9WVJ5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Crystallins are the dominant structural components of the vertebrate eye lens. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Compositional bias (1); Domain (4); Initiator methionine (1); Modified residue (1); Region (4) |
| Keywords | Acetylation;Eye lens protein;Methylation;Reference proteome;Repeat |
| Interact With | P23928 |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 2; /note=N-acetylserine; /evidence=ECO:0000250|UniProtKB:P53674 |
| Post Translational Modification | PTM: Specific cleavages in the N-terminal arm occur during lens maturation and give rise to truncated forms, leading to impaired oligomerization and protein insolubilization. The protease responsible for this partial degradation could be calpain II. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10080188; 10595510; 10603348; 11217851; 11309658; 11406268; 11714668; 11836498; 11850820; 12466851; 12506076; 14610273; 15452066; 15593327; 18823128; 19071118; 19623612; 19746987; 20105280; 21998302; 23426374; 24753151; 25530357; 26719333; 28384713; 28552735; 30646012; 30683901; 8575764; 8817455; 8954727; 9070650; 9693140; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,003 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |