| IED ID | IndEnz0002005510 |
| Enzyme Type ID | protease005510 |
| Protein Name |
Cystatin cpi-1 Cysele1 |
| Gene Name | cpi-1 K08B4.6 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MRFILLIALVFAVLDGINCQIAGGLSDVNASEYTGAAWNSVPEINSKNNGQNYMVPIKVVKAQVQVVAGTNTVLEVLVGESTCPRQGSVQASQVTAANCPLKSGGKRELYKVSIWEKPWENFKQTKAEKIRGVKPDEKI |
| Enzyme Length | 139 |
| Uniprot Accession Number | G5EDZ9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cysteine protease inhibitor which inhibits members of the peptidase C1 family (PubMed:12704112, PubMed:15664654). Does not inhibit asparaginyl endopeptidase (PubMed:15664654). May play a protective role against exogenous cysteine proteases derived from soil bacteria or fungi, or rotting fruits and vegetation (PubMed:24001183). {ECO:0000269|PubMed:12704112, ECO:0000269|PubMed:15664654, ECO:0000269|PubMed:24001183}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Glycosylation (1); Motif (1); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10778742; 14704431; 19123269; 19503598; 19922876; 22267497; 22560298; 23800452; 24884423; 25487147; 26009280; 29348603; 29748380; 6593563; |
| Motif | MOTIF 65..69; /note=Secondary area of contact; /evidence=ECO:0000305 |
| Gene Encoded By | |
| Mass | 15,091 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |