| IED ID | IndEnz0002005511 |
| Enzyme Type ID | protease005511 |
| Protein Name |
Leukocyte cysteine proteinase inhibitor 1 PLCPI Stefin-D1 |
| Gene Name | |
| Organism | Sus scrofa (Pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Suina Suidae (pigs) Sus Sus scrofa (Pig) |
| Enzyme Sequence | MESEEMLAGGLTEPRPATPEIQEIANKVKPQLEEKTNKTYEKFEAIIYRSQVVAGTNYYIKVHVGGNNYVHIRVFQSLPHQEDPLKLIGYQVDKTKDDELTGF |
| Enzyme Length | 103 |
| Uniprot Accession Number | P35479 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Potent inhibitor of cathepsins L and S, and papain. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Modified residue (1); Motif (1); Region (1); Site (1) |
| Keywords | Cytoplasm;Direct protein sequencing;Protease inhibitor;Reference proteome;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | MOD_RES 1; /note=Blocked amino end (Met); partial |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 51..55; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 11,767 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |