| IED ID | IndEnz0002005514 |
| Enzyme Type ID | protease005514 |
| Protein Name |
Cytochrome c oxidase subunit 6C Cytochrome c oxidase polypeptide VIc |
| Gene Name | COX6C |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK |
| Enzyme Length | 75 |
| Uniprot Accession Number | P09669 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix. {ECO:0000250|UniProtKB:P04038}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Energy metabolism; oxidative phosphorylation. {ECO:0000250|UniProtKB:P04038}. |
| nucleotide Binding | |
| Features | Chain (1); Topological domain (2); Transmembrane (1) |
| Keywords | 3D-structure;Direct protein sequencing;Membrane;Mitochondrion;Mitochondrion inner membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | P42858; P21673 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000269|PubMed:30030519}; Single-pass membrane protein {ECO:0000269|PubMed:30030519}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | Electron microscopy (1) |
| Cross Reference PDB | 5Z62; |
| Mapped Pubmed ID | 11340051; 12969439; 15223; 16169070; 16760263; 17264172; 17298220; 17353931; 17500595; 19064571; 19688755; 19843159; 20195357; 20877624; 21911578; 21958598; 21988832; 22860893; 22902835; 23260140; 23746447; 24344204; 24725412; 25203353; 26496610; 26752685; 28698372; 29505834; 7979252; |
| Motif | |
| Gene Encoded By | |
| Mass | 8,781 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |