| IED ID | IndEnz0002005533 |
| Enzyme Type ID | protease005533 |
| Protein Name |
Protein EPIDERMAL PATTERNING FACTOR 1 Cleaved into: MEPF1 |
| Gene Name | EPF1 At2g20875 F5H14 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MKSLLLLAFFLSFFFGSLLARHLPTSSHPSHHHVGMTGALKRQRRRPDTVQVAGSRLPDCSHACGSCSPCRLVMVSFVCASVEEAETCPMAYKCMCNNKSYPVP |
| Enzyme Length | 104 |
| Uniprot Accession Number | Q8S8I4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Controls stomatal patterning. Regulates asymmetric cell division during guard cell differentiation. Mediates stomatal development inhibition. Not cleaved by the protease CRSP (AC Q9LNU1) (PubMed:25043023). MEPF1: mobile signal controlling stomatal development in a non-cell-autonomous manner (PubMed:22241782). Uses ERL1 as major receptor (PubMed:22241782). May act by competing with somatogen (AC Q9SV72) for the same receptor, TMM (AC Q9SSD1) (PubMed:22027592). {ECO:0000269|PubMed:17639078, ECO:0000269|PubMed:19435754, ECO:0000269|PubMed:22241782, ECO:0000269|PubMed:25043023, ECO:0000303|PubMed:22027592}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (3); Chain (2); Disulfide bond (4); Glycosylation (1); Signal peptide (1) |
| Keywords | 3D-structure;Developmental protein;Disulfide bond;Glycoprotein;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Not induced by high CO(2). {ECO:0000269|PubMed:25043023}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 5XJO; |
| Mapped Pubmed ID | 18266617; 19042149; 19398336; 19565615; 20007289; 20010603; 20056678; 20149115; 21509541; 22232766; 22819466; 23662679; 23686240; 23755192; 23997204; 25754246; 27446127; 28266915; 28536146; 32347073; 32816968; 33193542; |
| Motif | |
| Gene Encoded By | |
| Mass | 11,444 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |