| IED ID | IndEnz0002005553 |
| Enzyme Type ID | protease005553 |
| Protein Name |
Putative GPI-anchor transamidase GPI transamidase EC 3.-.-.- Phosphatidylinositol glycan anchor biosynthesis protein class K |
| Gene Name | PIG-K CG4406 |
| Organism | Drosophila melanogaster (Fruit fly) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly) |
| Enzyme Sequence | MFNIMLVKFVVIFALILASCRVEADNTSVLPEGFVDAAQRSTHTNNWAVLVDASRFWFNYRHVANVLSIYRSVKRLGIPDSQIILMIADDMACNARNPRPGQVYNNANQHINVYGDDVEVDYRGYEVTVENFVRLLTGRTQNGTARSKKLLSDAGSNVLIYLTGHGGDGFLKFQDSEEITSQELADGIQQMWEKKRYNELFFMVDTCQAASLYEKFTSPNVLAVASSLVGEDSLSHHVDPSIGVYMIDRYTYYALEFLEKVQPFSKRTIGEFLQVCPKRVCISTVGVRKDLYPRDPHKVPITDFFGAIRPTRVSTDRINVTLANEDDFIFDKDKMVTKKPFKIVMESQFPSELFK |
| Enzyme Length | 355 |
| Uniprot Accession Number | Q8T4E1 |
| Absorption | |
| Active Site | ACT_SITE 165; /evidence=ECO:0000250|UniProtKB:Q92643; ACT_SITE 207; /evidence=ECO:0000250|UniProtKB:Q92643 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.-.-.- |
| Enzyme Function | FUNCTION: Mediates GPI anchoring in the endoplasmic reticulum, by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. During this transamidation reaction, the GPI transamidase forms a carbonyl intermediate with the substrate protein (By similarity). {ECO:0000250|UniProtKB:Q92643}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis. |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Erroneous gene model prediction (1); Signal peptide (1) |
| Keywords | GPI-anchor biosynthesis;Hydrolase;Protease;Reference proteome;Signal;Thiol protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11337470; 16243437; 17978101; 20620954; 23071443; 23084835; 23250212; 25312911; 25848931; 27172210; 30837153; 30914202; 31068592; 31722958; 33496978; |
| Motif | |
| Gene Encoded By | |
| Mass | 40,368 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |