| IED ID | IndEnz0002005568 |
| Enzyme Type ID | protease005568 |
| Protein Name |
Stem bromelain EC 3.4.22.32 |
| Gene Name | |
| Organism | Ananas comosus (Pineapple) (Ananas ananas) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Bromeliaceae Bromelioideae Ananas Ananas comosus (Pineapple) (Ananas ananas) |
| Enzyme Sequence | AVPQSIDWRDYGAVTSVKNQNPCGACWAFAAIATVESIYKIKKGILEPLSEQQVLDCAKGYGCKGGWEFRAFEFIISNKGVASGAIYPYKAAKGTCKTDGVPNSAYITGYARVPRNNESSMMYAVSKQPITVAVDANANFQYYKSGVFNGPCGTSLNHAVTAIGYGQDSIIYPKKWGAKWGEAGYIRMARDVSSSSGICGIAIDPLYPTLEE |
| Enzyme Length | 212 |
| Uniprot Accession Number | P14518 |
| Absorption | |
| Active Site | ACT_SITE 26; /evidence=ECO:0000250; ACT_SITE 158; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Broad specificity for cleavage of proteins, but strong preference for Z-Arg-Arg-|-NHMec among small molecule substrates.; EC=3.4.22.32; |
| DNA Binding | |
| EC Number | 3.4.22.32 |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (3); Glycosylation (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Thiol protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 22,831 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.22.32; |