Detail Information for IndEnz0002005571
IED ID IndEnz0002005571
Enzyme Type ID protease005571
Protein Name 14-3-3-like protein 2
Gene Name ftt-2 F52D10.3
Organism Caenorhabditis elegans
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans
Enzyme Sequence MSDGKEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANETEGGN
Enzyme Length 248
Uniprot Accession Number Q20655
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Required for extension of lifespan by sir-2.1 (PubMed:16777605). Required to modulate lifespan, in concert with hcf-1, acting redundantly with 14-3-3-like protein par-5 (PubMed:21909281). Promotes nuclear export of yap-1 (PubMed:23396260). Negatively regulates the transcriptional activity of daf-16 by sequestering it to the cytoplasm (PubMed:21531333). {ECO:0000269|PubMed:16777605, ECO:0000269|PubMed:21531333, ECO:0000269|PubMed:21909281, ECO:0000269|PubMed:23396260}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Mutagenesis (1); Site (1)
Keywords Cytoplasm;Nucleus;Reference proteome
Interact With G5EC23; Q11184; Q21921
Induction
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16777605, ECO:0000305|PubMed:21531333}. Nucleus {ECO:0000269|PubMed:16777605}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 11784094; 14704431; 16507136; 16672054; 16845399; 16860373; 17098225; 17417969; 17704769; 19123269; 19597959; 19922876; 20308279; 20620993; 21110867; 21177967; 22500807; 22560298; 23604319; 23800452; 25487147; 26009280; 26952210; 27129311; 27457958; 27506200; 28549065; 28648843; 29348603; 30353013; 31216475; 9171285;
Motif
Gene Encoded By
Mass 28,067
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda