| IED ID | IndEnz0002005682 |
| Enzyme Type ID | protease005682 |
| Protein Name |
CASP8 and FADD-like apoptosis regulator Caspase homolog CASH Caspase-eight-related protein Casper Caspase-like apoptosis regulatory protein CLARP Cellular FLICE-like inhibitory protein c-FLIP FADD-like antiapoptotic molecule 1 FLAME-1 Inhibitor of FLICE I-FLICE MACH-related inducer of toxicity MRIT Usurpin Cleaved into: CASP8 and FADD-like apoptosis regulator subunit p43; CASP8 and FADD-like apoptosis regulator subunit p12 |
| Gene Name | CFLAR CASH CASP8AP1 CLARP MRIT |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT |
| Enzyme Length | 480 |
| Uniprot Accession Number | O15519 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity. {ECO:0000269|PubMed:9880531}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (18); Beta strand (7); Chain (2); Domain (2); Helix (10); Mutagenesis (2); Natural variant (1); Region (9); Sequence conflict (8); Site (2); Turn (1) |
| Keywords | 3D-structure;Alternative splicing;Apoptosis;Host-virus interaction;Reference proteome;Repeat |
| Interact With | Q92851; Q14790; Q13077; Q14790; Q14790-2; Q02750; O14733; Q92851-4 |
| Induction | INDUCTION: Repressed by IL2/interleukin-2 after TCR stimulation, during progression to the S phase of the cell cycle. {ECO:0000269|PubMed:10227994}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Proteolytically processed by CASP8 generating subunit p43 and p12. {ECO:0000269|PubMed:9228018}. |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (2); X-ray crystallography (2) |
| Cross Reference PDB | 2N5R; 3H11; 3H13; 6M6O; |
| Mapped Pubmed ID | 10837247; 10894160; 11384965; 11463813; 11830587; 11877293; 11940602; 12031968; 12060768; 12115181; 12215447; 12393527; 12407100; 12432255; 12477972; 12496285; 12496481; 12496482; 12552004; 12556488; 12574377; 12592338; 12620239; 12620240; 12716387; 12746452; 12820373; 12887920; 12912912; 14562111; 14578361; 14637155; 15024054; 15078899; 15096587; 15183989; 15258564; 15273717; 15289496; 15297424; 15304499; 15334061; 15354734; 15459191; 15485835; 15540114; 15557152; 15644494; 15653751; 15686714; 15701649; 15701651; 15722350; 15731171; 15760909; 15761846; 15815586; 15843523; 15864316; 15886205; 15899875; 15917295; 15956881; 16014121; 16052233; 16052516; 16077198; 16211288; 16247474; 16298825; 16304056; 16403915; 16436054; 16441226; 16472594; 16611896; 16720717; 16740746; 16901543; 17047155; 17056549; 17070520; 17272514; 17327223; 17353931; 17376892; 17440816; 17441421; 17450141; 17513603; 17559541; 17573774; 17581950; 17638906; 17646662; 17659339; 17697742; 17726263; 17762208; 17912957; 17922291; 17932249; 17982483; 17988665; 18073330; 18084329; 18189268; 18190721; 18243739; 18256533; 18257744; 18264131; 18339897; 18391984; 18398344; 18414015; 18485876; 18509086; 18593367; 18603835; 18726983; 18767116; 18820704; 18823309; 18838202; 18840411; 19090833; 19109151; 19115040; 19161534; 19177145; 19203346; 19223508; 19243385; 19249545; 19278658; 19282655; 19339247; 19343040; 19363595; 19372246; 19398149; 19409438; 19416807; 19427028; 19433309; 19439735; 19476635; 19524512; 19543235; 19573080; 19604093; 19683492; 19710364; 19728335; 19734124; 19773279; 19798106; 19802016; 19816511; 19890350; 19896469; 19906927; 19913121; 19949310; 19956887; 20087343; 20097879; 20218968; 20224598; 20227749; 20335528; 20372864; 20449949; 20453000; 20561424; 20568250; 20595005; 20628086; 20628624; 20689807; 20696707; 20711500; 20802294; 20812013; 20876774; 20882347; 20951169; 20975036; 21048031; 21071136; 21107885; 21153369; 21235526; 21307400; 21403465; 21435442; 21454681; 21480219; 21525012; 21562857; 21638304; 21691254; 21737330; 21803845; 21856935; 21868755; 21912376; 21988832; 22027693; 22072062; 22126763; 22190004; 22219201; 22288650; 22345097; 22393362; 22504646; 22683265; 22753273; 22781394; 22817896; 22842544; 23028678; 23167276; 23230268; 23235765; 23247197; 23255321; 23319802; 23322903; 23371318; 23483900; 23518915; 23519470; 23541952; 23615398; 23678861; 23696271; 23853530; 24005232; 24355299; 24398693; 24438025; 24488010; 24502978; 24556678; 24603337; 24711168; 24816846; 24909691; 24946096; 25017325; 25019384; 25036637; 25230899; 25241761; 25416956; 25578476; 25816367; 25951185; 26025363; 26053096; 26142735; 26195820; 26258756; 26261530; 26448608; 26494467; 26529318; 26648023; 26667821; 26682748; 26716649; 26847085; 26972480; 26972597; 26990987; 26992204; 27092874; 27178057; 27210546; 27342840; 27573448; 27607580; 27619661; 27721066; 27746017; 28028178; 28035061; 28096440; 28218919; 28270653; 28498435; 28498469; 28537677; 28670784; 28863158; 29204645; 29222334; 29374180; 29434187; 29445085; 29681455; 29684585; 29741767; 29777390; 29875248; 30066934; 30127367; 30158588; 30248539; 30361438; 30518925; 30862357; 31046799; 31097685; 31638235; 31740779; 31908105; 31954371; 32313199; 32958259; 33837174; 9721089; |
| Motif | |
| Gene Encoded By | |
| Mass | 55,344 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |