| IED ID | IndEnz0002005689 |
| Enzyme Type ID | protease005689 |
| Protein Name |
Antithrombin-III ATIII Serpin C1 Fragment |
| Gene Name | SERPINC1 AT3 |
| Organism | Gallus gallus (Chicken) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken) |
| Enzyme Sequence | MHLFIGVSLRPLGHGIPAPYAVEDICTAKPRDIPVNPICIYRNPEKKPQERRGAGAGEGQDPGVHKPPASGSCPGPTRAFGRRSFLQAPGPTPRTMRRTSSCRPS |
| Enzyme Length | 105 |
| Uniprot Accession Number | Q03352 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin, matriptase-3/TMPRSS7, as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1); Region (1); Sequence conflict (1); Signal peptide (1) |
| Keywords | Blood coagulation;Direct protein sequencing;Hemostasis;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000269|PubMed:6920385 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,281 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |