| IED ID | IndEnz0002005695 |
| Enzyme Type ID | protease005695 |
| Protein Name |
Antistasin ATS Blood coagulation factor Xa/proclotting enzyme inhibitor |
| Gene Name | |
| Organism | Haementeria officinalis (Mexican leech) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Annelida Clitellata Hirudinea (leeches) Rhynchobdellida Glossiphoniidae Haementeria Haementeria officinalis (Mexican leech) |
| Enzyme Sequence | MIKLAILLLFTVAIVRCQGPFGPGCEEAGCPEGSACNIITDRCTCSGVRCRMHCPHGFQRSRYGCEFCKCRLEPMKATCDISECPEGMMCSRLTNKCDCKIDINCRKTCPNGLKRDKLGCEYCECRPKRKLIPRLS |
| Enzyme Length | 136 |
| Uniprot Accession Number | P15358 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This highly disulfide-bonded protein is a potent inhibitor of factor Xa. May have therapeutic utility as an anticoagulant. Also exhibits a strong metastatic activity. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Chain (1); Disulfide bond (10); Domain (2); Helix (2); Modified residue (1); Natural variant (4); Region (2); Signal peptide (1); Site (2); Turn (2) |
| Keywords | 3D-structure;Blood coagulation;Direct protein sequencing;Disulfide bond;Hemostasis;Heparin-binding;Protease inhibitor;Pyrrolidone carboxylic acid;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 18; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:3164720 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..17; /evidence="ECO:0000269|PubMed:3164720, ECO:0000269|PubMed:8271959" |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1SKZ; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 15,225 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |