| IED ID | IndEnz0002005697 |
| Enzyme Type ID | protease005697 |
| Protein Name |
Antistasin ATS Blood coagulation factor Xa/proclotting enzyme inhibitor |
| Gene Name | |
| Organism | Hydra vulgaris (Hydra) (Hydra attenuata) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Hydrozoa (hydrozoans) Hydroidolina Anthoathecata Aplanulata Hydridae (hydras) Hydra Hydra vulgaris (Hydra) (Hydra attenuata) |
| Enzyme Sequence | MNYLFVFLALSAAVTFANAECNKIQCRMFCKFGFQQDENGCDICKCAERPEKKCSNRYCKMLCPEGFQVDANGCQICRCKRSALEAPEKKCDGLKQCKMHCENGFVRDENGCPKCECSKCKQFQCLIFCPHGNEVDENGCKTCKCKAAPEKKKCDDLKQCRMFCENGFVRDENGCKKCECNKCKNFICQIFCEYGNVVDENGCKTCKCNSKPLKLSLHCR |
| Enzyme Length | 220 |
| Uniprot Accession Number | P38977 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This highly disulfide-bonded protein is a potent inhibitor of factor Xa. Facilitates digestion of tissues and may also protect the gastric tissues from its own digestive enzymes. May have therapeutic utility as an anticoagulant. Also exhibits a strong metastatic activity. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (6); Signal peptide (1); Site (4) |
| Keywords | Blood coagulation;Hemostasis;Heparin-binding;Protease inhibitor;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,016 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |