| IED ID | IndEnz0002005718 |
| Enzyme Type ID | protease005718 |
| Protein Name |
Flotillin-2 Reggie-1 REG-1 |
| Gene Name | Flot2 Reg1 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKNATGAQV |
| Enzyme Length | 428 |
| Uniprot Accession Number | Q9Z2S9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May play a role in axon growth and regeneration. May be involved in epidermal cell adhesion and epidermal structure and function. {ECO:0000269|PubMed:9858255}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (3); Chain (1); Initiator methionine (1); Lipidation (4); Modified residue (1); Sequence conflict (1) |
| Keywords | Alternative splicing;Cell adhesion;Endosome;Lipoprotein;Membrane;Myristate;Palmitate;Phosphoprotein;Reference proteome |
| Interact With | |
| Induction | INDUCTION: By optic nerve injury. {ECO:0000269|PubMed:9858255}. |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000269|PubMed:9858255}. Endosome {ECO:0000250}. Membrane {ECO:0000250|UniProtKB:Q14254}; Lipid-anchor {ECO:0000250|UniProtKB:Q14254}. Note=In neuronal cells, associated with GPI-anchored cell-adhesion molecules. |
| Modified Residue | MOD_RES 405; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q14254 |
| Post Translational Modification | PTM: ZDHHC5-catalyzed palmitoylation may be required for the formation of higher-order complexes and for neurite outgrowth in cultured neural stem cells. {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14599293; 15293782; 16452278; 17007841; 17206938; 17482312; 18237819; 19258392; 19298817; 21187433; 21797867; 22878913; 23174179; 23622064; 24612608; 27676653; 30452906; |
| Motif | |
| Gene Encoded By | |
| Mass | 47,038 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |