Detail Information for IndEnz0002005721
IED ID IndEnz0002005721
Enzyme Type ID protease005721
Protein Name Fibrinogen beta chain
Cleaved into: Fibrinopeptide B; Fibrinogen beta chain
Fragment
Gene Name FGB
Organism Gallus gallus (Chicken)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken)
Enzyme Sequence ASVEYDNEEDSPQIDARAHRPLDKRQEAAPTLRPVAPPISGTGYQPRPPKQDKQAMKKGPIIYPDAGGCKHPLDELGVLCPTGCELQTTLLKQEKTVKPVLRDLKDRVAKFSDTSTTMYQYVNMIDNKLVKTQKQRKDNDIILSEYNTEMELHYNYIKDNLDNNIPSSLRVLRAVIDSLHKKIQKLENAIATQTDYCRSPCVASCNIPVVSGRECEDIYRKGGETSEMYIIQPDPFTTPYRVYCDMETDNGGWTLIQNRQDGSVNFGRAWDEYKRGFGNIAKSGGKKYCDTPGEYWLGNDKISQLTKIGPTKVLIEMEDWNGDKVSALYGGFTIHNEGNKYQLSVSNYKGNAGNALMEGASQLYGENRTMTIHNGMYFSTYDRDNDGWLTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGTYSWDMAKHGTDDGIVWMNWKGSWYSMKKMSMKIKPYFPD
Enzyme Length 463
Uniprot Accession Number Q02020
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. {ECO:0000250|UniProtKB:E9PV24}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Beta strand (17); Chain (1); Compositional bias (1); Disulfide bond (8); Domain (1); Glycosylation (1); Helix (12); Metal binding (3); Modified residue (1); Non-terminal residue (1); Peptide (1); Region (1); Site (1); Turn (1)
Keywords 3D-structure;Blood coagulation;Calcium;Coiled coil;Direct protein sequencing;Disulfide bond;Glycoprotein;Hemostasis;Metal-binding;Reference proteome;Secreted;Sulfation
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:10737772, ECO:0000269|PubMed:11601975}.
Modified Residue MOD_RES 5; /note=Sulfotyrosine; /evidence=ECO:0000250
Post Translational Modification PTM: Conversion of fibrinogen to fibrin is triggered by thrombin, which cleaves fibrinopeptides A and B from alpha and beta chains, and thus exposes the N-terminal polymerization sites responsible for the formation of the soft clot. The soft clot is converted into the hard clot by factor XIIIA which catalyzes the epsilon-(gamma-glutamyl)lysine cross-linking between gamma chains (stronger) and between alpha chains (weaker) of different monomers.
Signal Peptide
Structure 3D X-ray crystallography (2)
Cross Reference PDB 1EI3; 1M1J;
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 52,678
Kinetics
Metal Binding METAL 384; /note="Calcium"; /evidence="ECO:0000269|PubMed:11601975, ECO:0007744|PDB:1M1J"; METAL 386; /note="Calcium"; /evidence="ECO:0000269|PubMed:11601975, ECO:0007744|PDB:1M1J"; METAL 388; /note="Calcium; via carbonyl oxygen"; /evidence="ECO:0000269|PubMed:11601975, ECO:0007744|PDB:1M1J"
Rhea ID
Cross Reference Brenda