| IED ID | IndEnz0002005726 |
| Enzyme Type ID | protease005726 |
| Protein Name |
Pacifastin-like protease inhibitor cvp4 Cysteine-rich venom protein 4 |
| Gene Name | |
| Organism | Pimpla hypochondriaca (Parasitoid wasp) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Hymenoptera Apocrita (wasps ants and bees) Parasitoida Ichneumonoidea Ichneumonidae Pimplinae Pimplini Pimpla Pimpla hypochondriaca (Parasitoid wasp) |
| Enzyme Sequence | MGFLACALLVVATAHAATAIVNPETCEIGSNFKNYCNNCYCFDGVMDHALCTRESCDRNVWNEDGTRKFPKPGKWISEKENKKNDEPCTPGENFKYYCNDCQCLDGLRAHAMCTRMRCDRNVFNEDGTRKYPEPEKWNSEKERKKSDESCAPGASFKYYCNSCTCGAEGKVAEAQCTSQECDRYKWKKDGSKRPFTLDPVLHD |
| Enzyme Length | 203 |
| Uniprot Accession Number | Q8T0W2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin activity and prophenoloxidase (PPO) activation, an enzyme essential for both clotting and insect innate immune responses. It does not inhibit activity of chymotrypsin and protease K, and has no effect on phenoloxidase (PO) activity. {ECO:0000250|UniProtKB:A0A7M6UNN1}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (9); Domain (3); Region (1); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:15147757}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000269|PubMed:15147757 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,077 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |