| IED ID |
IndEnz0002005735 |
| Enzyme Type ID |
protease005735 |
| Protein Name |
Iron-uptake system permease protein FeuB
|
| Gene Name |
feuB BSU01620 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MYSKQWTRIILITSPFAIALSLLLSILYGAKHLSTDIVFTSLIHFDPGNTDHQIIWHSRIPRAAGALLIGAALAVSGALMQGITRNYLASPSIMGVSDGSAFIITLCMVLLPQSSSIEMMIYSFIGSALGAVLVFGLAAMMPNGFTPVQLAIIGTVTSMLLSSLSAAMSIYFQISQDLSFWYSARLHQMSPDFLKLAAPFFLIGIIMAISLSKKVTAVSLGDDISKSLGQKKKTIKIMAMLSVIILTGSAVALAGKIAFVGLVVPHITRFLVGSDYSRLIPCSCILGGIFLTLCDLASRFINYPFETPIEVVTSIIGVPFFLYLIKRKGGEQNG |
| Enzyme Length |
334 |
| Uniprot Accession Number |
P40410 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Involved in the uptake of iron. Probably responsible for the translocation of the substrate across the membrane. {ECO:0000269|PubMed:16672620}.; FUNCTION: Part of the ABC transporter complex FeuABC/YusV involved in import of the catecholate siderophores bacillibactin and enterobactin. {ECO:0000305|PubMed:16672620}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Transmembrane (9) |
| Keywords |
Cell membrane;Ion transport;Iron;Iron transport;Membrane;Reference proteome;Transmembrane;Transmembrane helix;Transport |
| Interact With |
|
| Induction |
INDUCTION: Induced by Btr in iron-limited conditions. {ECO:0000269|PubMed:17725565}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:20713508, ECO:0000269|PubMed:22882210}; Multi-pass membrane protein. Membrane raft {ECO:0000269|PubMed:20713508, ECO:0000269|PubMed:22882210}; Multi-pass membrane protein {ECO:0000255}. Note=Present in detergent-resistant membrane (DRM) fractions that may be equivalent to eukaryotic membrane rafts; these rafts include proteins involved in signaling, molecule trafficking and protein secretion. {ECO:0000269|PubMed:20713508, ECO:0000269|PubMed:22882210}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
35,897 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|