| IED ID | IndEnz0002005753 |
| Enzyme Type ID | protease005753 |
| Protein Name |
Rhomboid protease GlpG EC 3.4.21.105 Intramembrane serine protease |
| Gene Name | glpG HI_0618 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Pasteurellales Pasteurellaceae Haemophilus Haemophilus influenzae Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Enzyme Sequence | MKNFLAQQGKITLILTALCVLIYLAQQLGFEDDIMYLMHYPAYEEQDSEVWRYISHTLVHLSNLHILFNLSWFFIFGGMIERTFGSVKLLMLYVVASAITGYVQNYVSGPAFFGLSGVVYAVLGYVFIRDKLNHHLFDLPEGFFTMLLVGIALGFISPLFGVEMGNAAHISGLIVGLIWGFIDSKLRKNSLE |
| Enzyme Length | 192 |
| Uniprot Accession Number | P44783 |
| Absorption | |
| Active Site | ACT_SITE 116; /note=Nucleophile; /evidence=ECO:0000269|PubMed:17210913; ACT_SITE 169; /evidence=ECO:0000269|PubMed:17210913 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleaves type-1 transmembrane domains using a catalytic dyad composed of serine and histidine that are contributed by different transmembrane domains.; EC=3.4.21.105; |
| DNA Binding | |
| EC Number | 3.4.21.105 |
| Enzyme Function | FUNCTION: Rhomboid-type serine protease that catalyzes intramembrane proteolysis. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Helix (10); Topological domain (7); Transmembrane (6); Turn (2) |
| Keywords | 3D-structure;Cell inner membrane;Cell membrane;Hydrolase;Membrane;Protease;Reference proteome;Serine protease;Transmembrane;Transmembrane helix |
| Interact With | Itself |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000269|PubMed:17210913}; Multi-pass membrane protein {ECO:0000269|PubMed:17210913}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 2NR9; 3ODJ; |
| Mapped Pubmed ID | 21295583; 25009246; |
| Motif | |
| Gene Encoded By | |
| Mass | 21,657 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.105; |