| IED ID | IndEnz0002005758 |
| Enzyme Type ID | protease005758 |
| Protein Name |
Protein inh Inhibitor of prohead protease gp21 |
| Gene Name | inh hoc.1 |
| Organism | Enterobacteria phage T4 (Bacteriophage T4) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae (phages with contractile tails) Tevenvirinae Tequatrovirus Enterobacteria phage T4 (Bacteriophage T4) |
| Enzyme Sequence | MIDKDYIAELKALDDNKEAKAKLAEYAEQFGIKVKKNKSFDNIVVDIEEALQKLASEPMPETDGLSIKDLIDAADAAEGLKYDDEEVNPEAALLIDSPIKSDIKIEVVETDKIPENTDVLIEDTPFVEEKFEQAVAEIIESEKPSVFTLPENFSPNLQLIGKNLGFCTVPWWIYQWIAETPDWKSHPTSFEHASAHQTLFSLIYYINRDGSVLIRETRNSSFVTLK |
| Enzyme Length | 226 |
| Uniprot Accession Number | P18058 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of the prohead protease gp21. Minor capsid protein. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Protease inhibitor;Reference proteome;Virion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,568 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |