| IED ID | IndEnz0002005760 |
| Enzyme Type ID | protease005760 |
| Protein Name |
Kallikrein-7 EC 3.4.21.117 Serine protease 6 Stratum corneum chymotryptic enzyme Thymopsin |
| Gene Name | Klk7 Prss6 Scce |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MGVWLLSLITVLLSLALETAGQGERIIDGYKCKEGSHPWQVALLKGNQLHCGGVLVDKYWVLTAAHCKMGQYQVQLGSDKIGDQSAQKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETMKTHR |
| Enzyme Length | 249 |
| Uniprot Accession Number | Q91VE3 |
| Absorption | |
| Active Site | ACT_SITE 66; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 108; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 201; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by Zn2+ and Cu2+ at low micromolar concentrations. Inhibited by SERPINA12 (By similarity). {ECO:0000250}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of proteins with aromatic side chains in the P1 position.; EC=3.4.21.117; |
| DNA Binding | |
| EC Number | 3.4.21.117 |
| Enzyme Function | FUNCTION: May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-|-Gln-15' and insulin B chain at '6-Leu-|-Cys-7', '16-Tyr-|-Leu-17', '25-Phe-|-Tyr-26' and '26-Tyr-|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (14); Chain (1); Disulfide bond (6); Helix (5); Propeptide (1); Region (1); Sequence conflict (1); Signal peptide (1); Site (1); Turn (1) |
| Keywords | 3D-structure;Disulfide bond;Hydrolase;Protease;Reference proteome;Secreted;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 5ZFH; 5ZFI; 6AHS; |
| Mapped Pubmed ID | 11874483; 12466851; 15192120; 15203212; 15331780; 15492784; 16117792; 17130451; 19592578; 20513444; 21267068; 26644517; 27551807; 28095415; 28932870; 29102227; 29311134; 29550094; 29884582; 30522951; 31883963; |
| Motif | |
| Gene Encoded By | |
| Mass | 27,257 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.117; |