| IED ID | IndEnz0002005773 |
| Enzyme Type ID | protease005773 |
| Protein Name |
Renal glandular kallikrein EC 3.4.21.35 Tissue kallikrein |
| Gene Name | |
| Organism | Mastomys natalensis (African soft-furred rat) (Praomys natalensis) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mastomys (multimammate rats) Mastomys natalensis (African soft-furred rat) (Praomys natalensis) |
| Enzyme Sequence | MWFLILFLALFLGGIDAAPPVQSRIIGGFNCEKNSQPWHVAVYRFARYQCGGVLLDANWVLTAAHCYNDKYQVWLGKNNRFEDEPSAQHQLISKAIPHPGFNMSLLNKDHTPHPEDDYSNDLMLVRLKKPAEITDVVKPIDLPTEEPTVGSRCLASGWGSTTPTEEFEYSHDLQCVYLELLSNEVCAKAHTEKVTDTMLCAGEMDGGKDTCVGDSGGPLICDGVLQGITSWGPTPCALPNVPGIYTKLIEYRSWIKDVMANNP |
| Enzyme Length | 263 |
| Uniprot Accession Number | P32824 |
| Absorption | |
| Active Site | ACT_SITE 65; /note=Charge relay system; ACT_SITE 121; /note=Charge relay system; ACT_SITE 215; /note=Charge relay system |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.; EC=3.4.21.35; |
| DNA Binding | |
| EC Number | 3.4.21.35 |
| Enzyme Function | FUNCTION: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (5); Domain (1); Glycosylation (1); Propeptide (1); Signal peptide (1) |
| Keywords | Disulfide bond;Glycoprotein;Hydrolase;Protease;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000305 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,130 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.35; |