| IED ID | IndEnz0002005780 |
| Enzyme Type ID | protease005780 |
| Protein Name |
Kallikrein 1-related peptidase b3 EC 3.4.21.35 7S nerve growth factor gamma chain Gamma-NGF Glandular kallikrein K3 mGK-3 Tissue kallikrein-3 Cleaved into: Nerve growth factor gamma chain 1; Nerve growth factor gamma chain 2 |
| Gene Name | Klk1b3 Klk-3 Klk3 Ngfg |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWHVAVYRYTQYLCGGVLLDPNWVLTAAHCYDDNYKVWLGKNNLFKDEPSAQHRFVSKAIPHPGFNMSLMRKHIRFLEYDYSNDLMLLRLSKPADITDTVKPITLPTEEPKLGSTCLASGWGSITPTKFQFTDDLYCVNLKLLPNEDCAKAHIEKVTDAMLCAGEMDGGKDTCKGDSGGPLICDGVLQGITSWGHTPCGEPDMPGVYTKLNKFTSWIKDTMAKNP |
| Enzyme Length | 261 |
| Uniprot Accession Number | P00756 |
| Absorption | |
| Active Site | ACT_SITE 65; /note=Charge relay system; ACT_SITE 120; /note=Charge relay system; ACT_SITE 213; /note=Charge relay system |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.; EC=3.4.21.35; |
| DNA Binding | |
| EC Number | 3.4.21.35 |
| Enzyme Function | FUNCTION: 7S NGF alpha chain stabilizes the 7S complex. The beta dimer promotes neurite growth. The gamma chain is an arginine-specific protease; it may also have plasminogen activator activity, as well as mitogenic activity for chick embryo fibroblasts. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (14); Chain (3); Disulfide bond (5); Domain (1); Glycosylation (1); Helix (6); Metal binding (2); Propeptide (1); Region (4); Sequence conflict (1); Signal peptide (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Glycoprotein;Growth factor;Hydrolase;Metal-binding;Protease;Reference proteome;Serine protease;Signal;Zinc;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000305 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1SGF; |
| Mapped Pubmed ID | 10456837; 10491653; 10651992; 11217851; 11556531; 12437987; 12466851; 12473665; 12766619; 1348494; 1412798; 1450512; 14704188; 14973275; 15203212; 1535334; 1572638; 1617216; 16800724; 1794054; 1981054; 2307474; 2377456; 3036794; 6200835; 7937857; 8040269; 8050673; 8288260; 8398147; 8452817; 8499946; 8535974; 8666393; 8812484; 8907554; 9615220; 9657861; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,998 |
| Kinetics | |
| Metal Binding | METAL 231; /note=Zinc; METAL 236; /note=Zinc |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.77; |