| IED ID | IndEnz0002005781 |
| Enzyme Type ID | protease005781 |
| Protein Name |
Kallikrein 1-related peptidase-like b4 7S nerve growth factor alpha chain Alpha-NGF |
| Gene Name | Klk1b4 Klk-4 Klk4 Ngfa |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MWFLILFLALSLGGIDAAPPVQSQVDCENSQPWHVAVYRFNKYQCGGVLLDRNWVLTAAHCYNDKYQVWLGKNNFLEDEPSDQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLSKPADITDVVKPITLPTEEPKLGSTCLASGWGSTTPIKFKYPDDLQCVNLKLLPNEDCDKAHEMKVTDAMLCAGEMDGGSYTCEHDSGGPLICDGILQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMANNP |
| Enzyme Length | 256 |
| Uniprot Accession Number | P00757 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (14); Chain (1); Disulfide bond (4); Domain (1); Helix (5); Metal binding (2); Natural variant (1); Region (1); Sequence conflict (2); Signal peptide (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Growth factor;Metal-binding;Reference proteome;Serine protease homolog;Signal;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: The presence of Gln-24 prevents cleavage of the activation peptide, which remains attached at the amino end of the mature alpha chain. |
| Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000269|PubMed:6712944 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1SGF; |
| Mapped Pubmed ID | 10234043; 10491653; 10651992; 11556531; 12383868; 12421715; 12437987; 12473665; 14704188; 14973275; 15203212; 15207235; 15496460; 15632075; 15728722; 16315017; 16602821; 16800724; 16967509; 17980967; 21677750; 3007510; 3036794; 6602295; 7666178; 8050368; 8050673; 8907554; 9852579; 9870956; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,548 |
| Kinetics | |
| Metal Binding | METAL 77; /note=Zinc; METAL 84; /note=Zinc |
| Rhea ID | |
| Cross Reference Brenda |