IED ID | IndEnz0002005799 |
Enzyme Type ID | protease005799 |
Protein Name |
Cystatin-F Cystatin-7 Cystatin-like metastasis-associated protein CMAP Leukocystatin |
Gene Name | CST7 |
Organism | Homo sapiens (Human) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
Enzyme Sequence | MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH |
Enzyme Length | 145 |
Uniprot Accession Number | O76096 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Inhibits papain and cathepsin L but with affinities lower than other cystatins. May play a role in immune regulation through inhibition of a unique target in the hematopoietic system. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Beta strand (3); Chain (1); Disulfide bond (4); Erroneous initiation (4); Glycosylation (2); Helix (3); Motif (1); Signal peptide (1); Site (1); Turn (1) |
Keywords | 3D-structure;Cytoplasm;Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
Interact With | P53634 |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:12423348}. Cytoplasm {ECO:0000269|PubMed:12423348}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..19; /evidence="ECO:0000255, ECO:0007744|PubMed:25944712" |
Structure 3D | X-ray crystallography (1) |
Cross Reference PDB | 2CH9; |
Mapped Pubmed ID | 15212960; 15752368; 18256700; 19192250; 20711500; 21344476; 22365146; 30033148; 31059105; 32947653; 33868254; |
Motif | MOTIF 81..85; /note=Secondary area of contact |
Gene Encoded By | |
Mass | 16,454 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |