IED ID | IndEnz0002005801 |
Enzyme Type ID | protease005801 |
Protein Name |
Cysteine proteinase inhibitor A Cystatin-A SCA |
Gene Name | |
Organism | Helianthus annuus (Common sunflower) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids campanulids Asterales Asteraceae Asteroideae Heliantheae alliance Heliantheae Helianthus Helianthus annuus (Common sunflower) |
Enzyme Sequence | SLEIDELARFAVDEHNKKQNALLEFGKVVNTKEQVVAGKMYYITLEATNGGVKKTYEAKVWVKPWENFKELQEFKPVDAATS |
Enzyme Length | 82 |
Uniprot Accession Number | Q10992 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Strong inhibitor of papain and ficin but poor inhibitor of cathepsin H, B and L. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1) |
Keywords | Direct protein sequencing;Protease inhibitor;Thiol protease inhibitor |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 9,363 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |