| IED ID | IndEnz0002005817 |
| Enzyme Type ID | protease005817 |
| Protein Name |
Secreted aspartic protease FUS4 EC 3.4.23.- Fusarin biosynthesis protein 4 |
| Gene Name | FUS4 FFUJ_10055 |
| Organism | Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Nectriaceae Fusarium Fusarium fujikuroi species complex Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi) Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi) |
| Enzyme Sequence | MLAIATLHVALQVFGAFSLSHAAAVTLEHRSAGNSNIAAIPAKWDVYGYLFNVTVGSPPQNITMLSDMTWMAPFVRSGRCLSQFNPELCVAQGQSFFNEHDSTTFGNTTFAQATWPVTAFAPNFTVDYGRDKFCIGNICNKDILMQVSDFPYPGSVVPVIPFGGIFGLAPTPKTITETSEPVNFQAWKNGNMGPLVGWHTCEVLKSAASCQGGDAQLVFGGTDTTMYSAKKIQSYEIQNPEWLSDAFYPSTPPRSNYWTVVDEGSEGLGAPLSLNGYKYLVRHIKSAKLASKAIVQNIQQQGSSGYNTANQDWYTVSCDGLDEFPNLVYQLDGRKKYTISPGDYVTKLTDMPGSVCYLNVNVWKYGRTENGDARVVLLGKAFLKRKYLVLNFEERSFGLAPLLTG |
| Enzyme Length | 405 |
| Uniprot Accession Number | S0ELJ9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.23.- |
| Enzyme Function | FUNCTION: Secreted aspartic protease; part of the gene cluster that mediates the biosynthesis of the mycotoxin fusarin C (PubMed:23932525). Within the cluster, FUS1, FUS2, FUS8 and FUS9 are sufficient for fusarin production (PubMed:23932525). The other FUS cluster members are not essential for fusarin C biosynthesis (PubMed:23932525). {ECO:0000269|PubMed:23932525}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Domain (1); Glycosylation (4); Signal peptide (1) |
| Keywords | Aspartyl protease;Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Expressed under high amounts of nitrogen via regulation by GLN1 (PubMed:23932525). Moreover, components of the fungal-specific velvet complex VEL1, VEL2 and LAE1 act also as positive regulators of expression (PubMed:20572938, PubMed:23932525). Finally, expression is induced under acidic conditions in a PACC-independent manner (PubMed:23932525). {ECO:0000269|PubMed:20572938, ECO:0000269|PubMed:23932525}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:D4ATH2}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 44,408 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |