Detail Information for IndEnz0002005826
IED ID IndEnz0002005826
Enzyme Type ID protease005826
Protein Name Gag polyprotein
Pr55Gag

Cleaved into: Matrix protein p17
MA
; Capsid protein p24
CA
; Spacer peptide p2; Nucleocapsid protein p7
NC
; Spacer peptide p1; p6-gag
Gene Name gag
Organism Simian immunodeficiency virus (isolate PBj14/BCL-3) (SIV-sm) (Simian immunodeficiency virus sooty mangabey monkey)
Taxonomic Lineage Viruses Riboviria Pararnavirae Artverviricota Revtraviricetes Ortervirales Retroviridae Orthoretrovirinae Lentivirus Simian immunodeficiency virus (SIV) Simian immunodeficiency virus - sm Simian immunodeficiency virus (isolate PBj14/BCL-3) (SIV-sm) (Simian immunodeficiency virus sooty mangabey monkey)
Enzyme Sequence MGARNSVLSGKKADELEKIRLRPGGKKRYQLKHIVWAANELDRFGLAESLLENKEGCQKILSVLAPLVPTGSENLKSLYNTVCVLWCIHAEEKVKHTEEAKQIVQRHLVVETGTADKMPATSRPTAPPSGKGGNYPVQQIGGNYTHLPLSPRTLNAWVKLIEEKKFGAEVVPGFQALSEGCTPYDINQMLNCVGEHQAAMQIIREIINEEAADWDLQHPQPGPIPPGQLREPRGSDIAGTTSTVDEQIQWMYRQQNPIPVGNIYRRWIQLGLQKCVRMYNPTNILDVKQGPKEPFQSYVDRFYKSLRAEQTDPAVKNWMTQTLLIQNANPDCKLVLKGLGINPTLEEMLTACQGVGGPGQKARLMAEALKDALTQGPLPFAAVQQKGQRKIIKCWNCGKEGHSARQCRAPRRQGCWKCGKAGHVMAKCPERQAGFLGLGPWGKKPRNFPMAQMPQGLTPTAPPEDPAVDLLKNYMKMGRRQRENRERPYKEVTEDLLHLNSLFGEDQ
Enzyme Length 507
Uniprot Accession Number P19504
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Matrix protein p17 targets Gag and Gag-Pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus. Also mediates nuclear localization of the preintegration complex. Implicated in the release from host cell mediated by Vpu (By similarity). {ECO:0000250}.; FUNCTION: Capsid protein p24 forms the conical core of the virus that encapsulates the genomic RNA-nucleocapsid complex. {ECO:0000250}.; FUNCTION: Nucleocapsid protein p7 encapsulates and protects viral dimeric unspliced (genomic) RNA. Binds these RNAs through its zinc fingers (By similarity). {ECO:0000250}.; FUNCTION: p6-gag plays a role in budding of the assembled particle by interacting with the host class E VPS proteins TSG101 and PDCD6IP/AIP1. {ECO:0000250}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (5); Initiator methionine (1); Lipidation (1); Motif (3); Peptide (2); Site (2); Zinc finger (2)
Keywords Capsid protein;Host cell membrane;Host cytoplasm;Host membrane;Host nucleus;Host-virus interaction;Lipoprotein;Membrane;Metal-binding;Myristate;Phosphoprotein;RNA-binding;Reference proteome;Repeat;Ribosomal frameshifting;Viral budding;Viral budding via the host ESCRT complexes;Viral nucleoprotein;Viral release from host cell;Virion;Zinc;Zinc-finger
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: [Matrix protein p17]: Virion {ECO:0000305}. Host nucleus {ECO:0000250}. Host cytoplasm {ECO:0000250}. Host cell membrane {ECO:0000305}; Lipid-anchor {ECO:0000305}. Note=Following virus entry, the nuclear localization signal (NLS) of the matrix protein participates with Vpr to the nuclear localization of the viral genome. During virus production, the nuclear export activity of the matrix protein counteracts the NLS to maintain the Gag and Gag-Pol polyproteins in the cytoplasm, thereby directing unspliced RNA to the plasma membrane (By similarity). {ECO:0000250}.; SUBCELLULAR LOCATION: [Capsid protein p24]: Virion {ECO:0000305}.; SUBCELLULAR LOCATION: [Nucleocapsid protein p7]: Virion {ECO:0000305}.
Modified Residue
Post Translational Modification PTM: Capsid protein p24 is phosphorylated. {ECO:0000250}.; PTM: Specific enzymatic cleavages by the viral protease yield mature proteins. The polyprotein is cleaved during and after budding, this process is termed maturation (By similarity). {ECO:0000250}.
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif MOTIF 16..22; /note=Nuclear export signal; /evidence=ECO:0000250; MOTIF 26..32; /note=Nuclear localization signal; /evidence=ECO:0000250; MOTIF 459..462; /note=PTAP/PSAP motif
Gene Encoded By
Mass 56,667
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda