| IED ID | IndEnz0002005831 |
| Enzyme Type ID | protease005831 |
| Protein Name |
Dipeptidyl peptidase 3 EC 3.4.14.4 Dipeptidyl aminopeptidase III Dipeptidyl arylamidase III Dipeptidyl peptidase III DPP III Proctolinase Fragments |
| Gene Name | |
| Organism | Blaberus craniifer (Death's head cockroach) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Polyneoptera Dictyoptera Blattodea (cockroaches) Blaberoidea Blaberidae (ovoviviparous cockroach family) Blaberinae Blaberus Blaberus craniifer (Death's head cockroach) |
| Enzyme Sequence | FANLVEKTTYFSDKGEFEGFVAMVNKNVTLGNVIPASYKLQVYKTYDATHEGLIQSFVENGTEEVPLDGXEXX |
| Enzyme Length | 73 |
| Uniprot Accession Number | P83681 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Release of an N-terminal dipeptide from a peptide comprising four or more residues, with broad specificity. Also acts on dipeptidyl 2-naphthylamides.; EC=3.4.14.4; Evidence={ECO:0000269|PubMed:11559363}; |
| DNA Binding | |
| EC Number | 3.4.14.4 |
| Enzyme Function | FUNCTION: Degrades neuropeptide proctolin (RYLPT) by cleavage between Tyr and Leu residues. {ECO:0000269|PubMed:11559363}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 5.1.; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (6) |
| Keywords | Aminopeptidase;Direct protein sequencing;Hydrolase;Membrane;Metalloprotease;Protease;Transmembrane;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000269|PubMed:11559363}; Multi-pass membrane protein {ECO:0000269|PubMed:11559363}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,129 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |