IED ID | IndEnz0002005837 |
Enzyme Type ID | protease005837 |
Protein Name |
Ficolin-1 Collagen/fibrinogen domain-containing protein 1 Ficolin-A Ficolin-alpha M-ficolin |
Gene Name | FCN1 FCNM |
Organism | Homo sapiens (Human) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
Enzyme Sequence | MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA |
Enzyme Length | 326 |
Uniprot Accession Number | O00602 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Extracellular lectin functioning as a pattern-recognition receptor in innate immunity. Binds the sugar moieties of pathogen-associated molecular patterns (PAMPs) displayed on microbes and activates the lectin pathway of the complement system. May also activate monocytes through a G protein-coupled receptor, FFAR2, inducing the secretion of interleukin-8/IL-8 (PubMed:21037097). Binds preferentially to 9-O-acetylated 2-6-linked sialic acid derivatives and to various glycans containing sialic acid engaged in a 2-3 linkage. {ECO:0000269|PubMed:20032467, ECO:0000269|PubMed:21037097}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Beta strand (16); Chain (1); Disulfide bond (3); Domain (2); Erroneous initiation (1); Glycosylation (1); Helix (7); Metal binding (4); Mutagenesis (3); Natural variant (3); Region (5); Sequence conflict (2); Signal peptide (1); Site (2); Turn (2) |
Keywords | 3D-structure;Calcium;Cell membrane;Collagen;Direct protein sequencing;Disulfide bond;Glycoprotein;Immunity;Innate immunity;Lectin;Membrane;Metal-binding;Reference proteome;Repeat;Secreted;Signal |
Interact With | P02741; P26022; Q2TS39; O15552; P26022; P02769; P9WQP3; P9WQP1 |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:20400674, ECO:0000269|PubMed:21037097}. Cell membrane {ECO:0000269|PubMed:20400674, ECO:0000269|PubMed:21037097}; Peripheral membrane protein {ECO:0000269|PubMed:20400674, ECO:0000269|PubMed:21037097}; Extracellular side {ECO:0000269|PubMed:20400674, ECO:0000269|PubMed:21037097}. Note=Found on the monocyte and granulocyte surface (PubMed:20400674). |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..29; /evidence=ECO:0000269|PubMed:15340161 |
Structure 3D | X-ray crystallography (7) |
Cross Reference PDB | 2D39; 2JHH; 2JHI; 2JHK; 2JHL; 2JHM; 2WNP; |
Mapped Pubmed ID | 10639434; 10925294; 11012776; 11532276; 12396008; 14280442; 15117939; 15199963; 15728497; 16116205; 16305643; 17581635; 17928056; 17938215; 18032536; 18343499; 19539995; 19741154; 19853918; 20237496; 20375634; 21112665; 21490156; 21689722; 21730084; 21974696; 22236007; 22391637; 22673311; 22941510; 23184524; 23209787; 23650620; 23817411; 24022747; 24161415; 25069872; 26154564; 26792363; 26984723; 27734336; 27981461; 27994205; 28060571; 28601054; 28900133; 30619357; 32142211; 32601370; 32915797; 33591573; 6019133; 70787; |
Motif | |
Gene Encoded By | |
Mass | 35,078 |
Kinetics | |
Metal Binding | METAL 262; /note="Calcium"; /evidence="ECO:0000269|PubMed:17148457, ECO:0000269|PubMed:17897951, ECO:0000269|PubMed:20032467, ECO:0007744|PDB:2D39, ECO:0007744|PDB:2WNP"; METAL 264; /note="Calcium"; /evidence="ECO:0000269|PubMed:17148457, ECO:0000269|PubMed:17897951, ECO:0000269|PubMed:20032467, ECO:0007744|PDB:2D39, ECO:0007744|PDB:2WNP"; METAL 266; /note="Calcium; via carbonyl oxygen"; /evidence="ECO:0000269|PubMed:17148457, ECO:0000269|PubMed:17897951, ECO:0000269|PubMed:20032467, ECO:0007744|PDB:2D39, ECO:0007744|PDB:2WNP"; METAL 268; /note="Calcium; via carbonyl oxygen"; /evidence="ECO:0000269|PubMed:17148457, ECO:0000269|PubMed:17897951, ECO:0000269|PubMed:20032467, ECO:0007744|PDB:2D39, ECO:0007744|PDB:2WNP" |
Rhea ID | |
Cross Reference Brenda |