| IED ID | IndEnz0002005849 |
| Enzyme Type ID | protease005849 |
| Protein Name |
Cathepsin B EC 3.4.22.1 Cathepsin B1 Cleaved into: Cathepsin B light chain; Cathepsin B heavy chain Fragments |
| Gene Name | CTSB |
| Organism | Coturnix japonica (Japanese quail) (Coturnix coturnix japonica) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Perdicinae Coturnix Coturnix japonica (Japanese quail) (Coturnix coturnix japonica) |
| Enzyme Sequence | LPDTFDSRKQWPNCPTISEIRDQGSVSVEVSAEDLLSCCGFECGMGCN |
| Enzyme Length | 48 |
| Uniprot Accession Number | P81494 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of proteins with broad specificity for peptide bonds. Preferentially cleaves -Arg-Arg-|-Xaa bonds in small molecule substrates (thus differing from cathepsin L). In addition to being an endopeptidase, shows peptidyl-dipeptidase activity, liberating C-terminal dipeptides.; EC=3.4.22.1; |
| DNA Binding | |
| EC Number | 3.4.22.1 |
| Enzyme Function | FUNCTION: Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (3); Non-adjacent residues (1); Non-terminal residue (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Hydrolase;Lysosome;Protease;Thiol protease |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Lysosome. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,226 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |