| IED ID | IndEnz0002005868 |
| Enzyme Type ID | protease005868 |
| Protein Name |
Cathepsin D EC 3.4.23.5 Cleaved into: Cathepsin D light chain; Cathepsin D heavy chain |
| Gene Name | CTSD CPSD |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL |
| Enzyme Length | 412 |
| Uniprot Accession Number | P07339 |
| Absorption | |
| Active Site | ACT_SITE 97; /evidence="ECO:0000255|PROSITE-ProRule:PRU10094, ECO:0000269|PubMed:8393577"; ACT_SITE 295; /evidence="ECO:0000255|PROSITE-ProRule:PRU10094, ECO:0000269|PubMed:8393577" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Specificity similar to, but narrower than, that of pepsin A. Does not cleave the 4-Gln-|-His-5 bond in B chain of insulin.; EC=3.4.23.5; |
| DNA Binding | |
| EC Number | 3.4.23.5 |
| Enzyme Function | FUNCTION: Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation (PubMed:27333034). Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease. {ECO:0000269|PubMed:27333034}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (27); Chain (3); Disulfide bond (4); Domain (1); Glycosylation (3); Helix (11); Natural variant (4); Propeptide (1); Signal peptide (1); Turn (6) |
| Keywords | 3D-structure;Alzheimer disease;Aspartyl protease;Direct protein sequencing;Disease variant;Disulfide bond;Glycoprotein;Hydrolase;Lysosome;Neurodegeneration;Neuronal ceroid lipofuscinosis;Protease;Reference proteome;Secreted;Signal;Zymogen |
| Interact With | P05067; Q9P1A6-3; I6L9I8; Q9H6S3; Q7Z602; P28799; P28799; P28799; P28799; P28799; P28799; P28799; P28799; P68431; Q9Y6F6-3; Q12756; Q5TA79; Q86VF5-3; O15130-2; Q96LB9; P09565; Q9C004; Q8NBJ7; Q9BQG1; P28347-2; P45880; Q15007-2; O00308; Q5W0Z9-4; Q6ZNH5 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Lysosome. Melanosome. Secreted, extracellular space. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV. In aortic samples, detected as an extracellular protein loosely bound to the matrix (PubMed:20551380). {ECO:0000269|PubMed:20551380}. |
| Modified Residue | |
| Post Translational Modification | PTM: N- and O-glycosylated. {ECO:0000269|PubMed:12754519, ECO:0000269|PubMed:16263699, ECO:0000269|PubMed:16335952, ECO:0000269|PubMed:19159218, ECO:0000269|PubMed:23234360}.; PTM: Undergoes proteolytic cleavage and activation by ADAM30. {ECO:0000269|PubMed:27333034}.; PTM: As well as the major heavy chain which starts at Leu-169, 2 minor forms starting at Gly-170 and Gly-171 have been identified (PubMed:1426530). An additional form starting at Ala-168 has also been identified (PubMed:27333034). {ECO:0000269|PubMed:1426530, ECO:0000269|PubMed:27333034}. |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (6) |
| Cross Reference PDB | 1LYA; 1LYB; 1LYW; 4OBZ; 4OC6; 4OD9; |
| Mapped Pubmed ID | 10072072; 10631941; 10748235; 10809954; 10986284; 11119712; 11136970; 11198280; 11304834; 11436125; 11684289; 11779865; 11780226; 11813165; 11840502; 11853874; 11906282; 12011767; 12045255; 12078484; 12083803; 12140763; 12147324; 12151789; 12185597; 12556904; 12651610; 12742663; 12748383; 12782337; 12782632; 12811635; 12826741; 12927775; 12970159; 14767531; 15001666; 15003956; 15081423; 15158911; 15168727; 15192082; 15211064; 15211070; 15318816; 15668295; 15739123; 15843343; 15896324; 16046058; 16081416; 16085063; 16127101; 16181339; 16263712; 16331270; 16354654; 16417614; 16543533; 16608402; 16652347; 16709808; 16784755; 16850161; 17032648; 17112520; 17174307; 17176069; 17188016; 17284061; 17340625; 17395004; 17532541; 17601350; 17875703; 18177262; 18202773; 18248894; 18307033; 18367545; 18387691; 18396902; 18426579; 18431031; 18494001; 18559512; 18566016; 18566385; 18624398; 18702517; 18762174; 18830724; 18977241; 19061927; 19109932; 19115690; 19221643; 19383337; 19389128; 19487283; 19494521; 19571726; 19802014; 19805454; 19828951; 19854241; 19913121; 19919557; 19926167; 19950226; 20000738; 20071328; 20083556; 20125193; 20217867; 20380117; 20385381; 20399529; 20430722; 20541250; 20562859; 20597865; 20628086; 20666480; 20666745; 20711500; 20826454; 20926008; 21148553; 21298030; 21311773; 21315176; 21470957; 21533003; 21632707; 21674799; 21709160; 21789704; 21948970; 22081071; 22190034; 22193701; 22244896; 22302483; 22388353; 22399610; 22439866; 22476353; 22528489; 22542809; 22623428; 22627201; 22816225; 22824147; 22898924; 22949512; 22964611; 23042275; 23065739; 23107604; 23219593; 23250759; 23415546; 23439581; 23466190; 23483898; 23499937; 23650620; 23840360; 23868063; 23871913; 23954850; 24044567; 24138030; 24198402; 24259486; 24281128; 24366813; 24423188; 24467213; 24511668; 24656773; 25086681; 25095637; 25611836; 25663755; 25665578; 25712867; 25852190; 25911051; 26018151; 26086961; 26183398; 26203049; 26344002; 26351775; 26448324; 26496610; 26507101; 26519755; 26657266; 26718887; 26867770; 26943237; 26995190; 27291402; 27922112; 28073925; 28218663; 28336215; 28390177; 28493053; 28543404; 28791438; 28917980; 29024694; 29036611; 29375176; 29501392; 29993134; 30037983; 30051532; 30227221; 30644102; 31099754; 31134487; 31340140; 31862139; 31910296; 31936569; 31960265; 32176724; 32253787; 32323319; 32578168; 32867726; 33202088; 33293479; 33445607; 33611777; 33713388; 33964876; 33991468; 34311200; 34638702; 4289389; 4322712; 4330891; 4360430; 8419924; 8687433; 9539769; 9545226; 9783744; |
| Motif | |
| Gene Encoded By | |
| Mass | 44,552 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.23.5; |