| IED ID | IndEnz0002005928 |
| Enzyme Type ID | protease005928 |
| Protein Name |
Cystatin-M Cystatin-6 Cystatin-E |
| Gene Name | CST6 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MARSNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM |
| Enzyme Length | 149 |
| Uniprot Accession Number | Q15828 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: High affinity inhibitor for cathepsin L, cathepsin L2 (cathepsin V), and legumain (PubMed:30425301). Involved in the regulation of epidermal cornification, and hair follicle morphogenesis and maintenance (PubMed:30425301). {ECO:0000269|PubMed:30425301}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Disulfide bond (2); Glycosylation (1); Helix (4); Motif (1); Natural variant (1); Signal peptide (1); Site (1); Turn (1) |
| Keywords | 3D-structure;Disease variant;Disulfide bond;Ectodermal dysplasia;Glycoprotein;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | O95070 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: Substrate for transglutaminases. Acts as an acyl acceptor but not as an acyl donor. |
| Signal Peptide | SIGNAL 1..28; /evidence=ECO:0000305 |
| Structure 3D | X-ray crystallography (5) |
| Cross Reference PDB | 4N6L; 4N6M; 4N6N; 4N6O; 6FK0; |
| Mapped Pubmed ID | 14676833; 15466187; 16356477; 16565075; 16912163; 17043665; 17099723; 17540367; 18506750; 18607344; 18676742; 18754876; 19005484; 19074894; 19262604; 19503093; 19551853; 20074384; 21092257; 21900206; 22688893; 22902879; 23006792; 24742492; 25630877; 25640309; 27090639; 28630039; 29530995; 29967063; |
| Motif | MOTIF 80..84; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 16,511 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |