| IED ID | IndEnz0002005948 |
| Enzyme Type ID | protease005948 |
| Protein Name |
Insulin-like 3 Leydig insulin-like peptide Ley-I-L Relaxin-like factor Cleaved into: Insulin-like 3 B chain; Insulin-like 3 A chain |
| Gene Name | Insl3 Rlf |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MRAPLLLMLLALGSALRSPQPPEARAKLCGHHLVRTLVRVCGGPRWSPEATQPVETRDRELLQWLEQRHLLHALVADVDPALDPQLPRQASQRQRRSAATNAVHRCCLTGCTQQDLLGLCPH |
| Enzyme Length | 122 |
| Uniprot Accession Number | O09107 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor (By similarity). {ECO:0000250, ECO:0000269|PubMed:10391220, ECO:0000269|PubMed:11342953}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Disulfide bond (3); Peptide (2); Propeptide (1); Sequence conflict (4); Signal peptide (1) |
| Keywords | Cleavage on pair of basic residues;Disulfide bond;Hormone;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..15; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10319319; 10486311; 10542371; 10650968; 10715534; 11170269; 11180952; 11818498; 12933905; 12943998; 14628051; 14666470; 15256493; 15956690; 16141072; 16223865; 16237153; 16949566; 17393433; 18303090; 18499751; 18534133; 18981061; 19100252; 19268447; 19420383; 19428929; 19520787; 19696014; 19950223; 20400152; 21147849; 21487003; 21613322; 21677750; 21900680; 23077169; 23087174; 23100620; 23136395; 23300479; 23840809; 24640567; 24780841; 24956260; 25289806; 25344072; 25668066; 25725066; 25933105; 26108792; 26823808; 29324782; 29438518; 30067986; 30178547; 30518625; 30793514; 31748609; 32301970; 32497091; 9110312; 9403069; |
| Motif | |
| Gene Encoded By | |
| Mass | 13,586 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |