| IED ID | IndEnz0002005949 |
| Enzyme Type ID | protease005949 |
| Protein Name |
Kallistatin Kallikrein inhibitor Peptidase inhibitor 4 PI-4 Serpin A4 |
| Gene Name | SERPINA4 KST PI4 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP |
| Enzyme Length | 427 |
| Uniprot Accession Number | P29622 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibitor due to cleavage at the reactive site by tissue kallikrein. {ECO:0000269|PubMed:8227002}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (19); Chain (1); Erroneous initiation (1); Glycosylation (4); Helix (12); Sequence conflict (2); Signal peptide (1); Site (1); Turn (7) |
| Keywords | 3D-structure;Direct protein sequencing;Glycoprotein;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: The N-terminus is blocked. |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 6F02; |
| Mapped Pubmed ID | 12384424; 12734113; 1435334; 17714861; 17729417; 19858207; 19913121; 20509975; 20628086; 21900206; 22710204; 23190873; 23394256; 23666756; 24129914; 25307947; 25654330; 26091968; 26156753; 26323298; 26790955; 27168012; 27326658; 28270177; 28294594; 28299632; 28440474; 28742513; 28744338; 29243194; 29387292; 29679615; 29729163; 31884974; 32558414; 32866127; 34465809; |
| Motif | |
| Gene Encoded By | |
| Mass | 48,542 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |