| IED ID | IndEnz0002005954 |
| Enzyme Type ID | protease005954 |
| Protein Name |
RxLR effector protein Avh240 Avirulence homolog protein 2402 |
| Gene Name | Avh240 PHYSODRAFT_288823 |
| Organism | Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines) |
| Taxonomic Lineage | cellular organisms Eukaryota Sar Stramenopiles Oomycota Peronosporales Peronosporaceae Phytophthora Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines) Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines) |
| Enzyme Sequence | MRPYFTLLLALAFILACTNLVEADAGRVLETTTNEHARHLRTAVASVVDLPDDEDERLLGYNTVQLWRMRRTANKLMNGKLTTQKEAALKKWMASQQDKFLAKWLKSSSVYPDQVYSKLGLTKLGASAKSSPNYQLYEKYTEALLQRWTNFKASPDTVYKSLRLDKLGAKAPQSPSYPMYEKYLQTFFRNQPAN |
| Enzyme Length | 194 |
| Uniprot Accession Number | G5A8M1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Effector that suppresses plant defense responses during the early stages of pathogen infection. Suppresses cell death induced by effectors and PAMPs in plant hosts (PubMed:21653195). Avh240 dimerizes and localizes at the plasma membrane to interfere with aspartic protease AP1 secretion, which presents an effective mechanism by which effector proteins suppress plant apoplastic immunity (PubMed:30703565). {ECO:0000269|PubMed:21653195, ECO:0000269|PubMed:30703565}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Motif (1); Mutagenesis (2); Region (1); Signal peptide (1) |
| Keywords | 3D-structure;Host cell membrane;Host membrane;Membrane;Reference proteome;Secreted;Signal;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:30703565}. Host cell membrane {ECO:0000269|PubMed:30703565}. Note=Plasma membrane localization is independent on self-dimerization but required for virulence. {ECO:0000269|PubMed:30703565}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 6J8L; |
| Mapped Pubmed ID | - |
| Motif | MOTIF 38..57; /note=RxLR-dEER; /evidence=ECO:0000305|PubMed:30703565 |
| Gene Encoded By | |
| Mass | 22,225 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |