| IED ID | IndEnz0002005968 |
| Enzyme Type ID | protease005968 |
| Protein Name |
Alanine carboxypeptidase EC 3.4.17.6 Fragment |
| Gene Name | |
| Organism | Geobacillus stearothermophilus (Bacillus stearothermophilus) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Geobacillus Geobacillus stearothermophilus (Bacillus stearothermophilus) |
| Enzyme Sequence | KAWFVLSMRAVGGLFVDLWTSVAKTVKGWL |
| Enzyme Length | 30 |
| Uniprot Accession Number | P13722 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Release of a C-terminal alanine from a peptide or a variety of pteroyl or acyl groups.; EC=3.4.17.6; |
| DNA Binding | |
| EC Number | 3.4.17.6 |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1) |
| Keywords | Carboxypeptidase;Direct protein sequencing;Hydrolase;Protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 3,367 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |