IED ID | IndEnz0002005983 |
Enzyme Type ID | protease005983 |
Protein Name |
Procathepsin L EC 3.4.22.15 Cathepsin L1 Cleaved into: Cathepsin L; Cathepsin L heavy chain; Cathepsin L light chain |
Gene Name | CTSL CTSL1 |
Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Carnivora Caniformia Canidae (dog coyote wolf fox) Canis Canis lupus (Gray wolf) Canis lupus familiaris (Dog) (Canis familiaris) |
Enzyme Sequence | MNPSLFLTALCLGIASAAPKFDQSLNAQWYQWKATHRRLYGMNEEGWRRAVWEKNMKMIELHNREYSQGKHGFTMAMNAFGDMTNEEFRQVMNGFQNQKHKKGKMFQEPLFAEIPKSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRAQGNEGCNGGLMDNAFRYVKDNGGLDSEESYPYLGRDTETCNYKPECSAANDTGFVDLPQREKALMKAVATLGPISVAIDAGHQSFQFYKSGIYFDPDCSSKDLDHGVLVVGYGFEGTDSNNKFWIVKNSWGPEWGWNGYVKMAKDQNNHCGIATAASYPTV |
Enzyme Length | 333 |
Uniprot Accession Number | Q9GL24 |
Absorption | |
Active Site | ACT_SITE 138; /evidence=ECO:0000250|UniProtKB:P07711; ACT_SITE 277; /evidence=ECO:0000250|UniProtKB:P07711; ACT_SITE 300; /evidence=ECO:0000250|UniProtKB:P07711 |
Activity Regulation | ACTIVITY REGULATION: Inhibited by the propeptide produced by autocleavage (By similarity). Long isoform of CD74/Ii chain stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of APCs. IFNG enhances the conversion into the CTSL mature and active form (By similarity). Inhibited by CST6. Inhibited by the glycopeptide antibiotic teicoplanin. Inhibited by amantadine (By similarity). {ECO:0000250|UniProtKB:P06797, ECO:0000250|UniProtKB:P07711}. |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Specificity close to that of papain. As compared to cathepsin B, cathepsin L exhibits higher activity toward protein substrates, but has little activity on Z-Arg-Arg-NHMec, and no peptidyl-dipeptidase activity.; EC=3.4.22.15; Evidence={ECO:0000250|UniProtKB:P07711}; |
DNA Binding | |
EC Number | 3.4.22.15 |
Enzyme Function | FUNCTION: Thiol protease important for the overall degradation of proteins in lysosomes (By similarity). Plays a critical for normal cellular functions such as general protein turnover, antigen processing and bone remodeling. Involved in the solubilization of cross-linked TG/thyroglobulin and in the subsequent release of thyroid hormone thyroxine (T4) by limited proteolysis of TG/thyroglobulin in the thyroid follicle lumen (By similarity). In neuroendocrine chromaffin cells secretory vesicles, catalyzes the prohormone proenkephalin processing to the active enkephalin peptide neurotransmitter (By similarity). In thymus, regulates CD4(+) T cell positive selection by generating the major histocompatibility complex class II (MHCII) bound peptide ligands presented by cortical thymic epithelial cells. Also mediates invariant chain processing in cortical thymic epithelial cells. Major elastin-degrading enzyme at neutral pH. Accumulates as a mature and active enzyme in the extracellular space of antigen presenting cells (APCs) to regulate degradation of the extracellular matrix in the course of inflammation (By similarity). Secreted form generates endostatin from COL18A1 (By similarity). Critical for cardiac morphology and function. Plays an important role in hair follicle morphogenesis and cycling, as well as epidermal differentiation (By similarity). Required for maximal stimulation of steroidogenesis by TIMP1 (By similarity). {ECO:0000250|UniProtKB:P06797, ECO:0000250|UniProtKB:P07154, ECO:0000250|UniProtKB:P07711, ECO:0000250|UniProtKB:P25975}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (3); Chain (3); Disulfide bond (3); Glycosylation (1); Propeptide (2); Signal peptide (1); Site (4) |
Keywords | Cell membrane;Cytoplasmic vesicle;Disulfide bond;Glycoprotein;Hydrolase;Lysosome;Membrane;Protease;Reference proteome;Secreted;Signal;Thiol protease;Zymogen |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Lysosome {ECO:0000250|UniProtKB:P06797}. Apical cell membrane {ECO:0000250|UniProtKB:P06797}; Peripheral membrane protein {ECO:0000250|UniProtKB:P06797}; Extracellular side {ECO:0000250|UniProtKB:P06797}. Cytoplasmic vesicle, secretory vesicle, chromaffin granule {ECO:0000250|UniProtKB:P25975}. Secreted, extracellular space {ECO:0000250|UniProtKB:P06797}. Secreted {ECO:0000250|UniProtKB:P06797}. Note=Localizes to the apical membrane of thyroid epithelial cells. Released at extracellular space by activated dendritic cells and macrophages. {ECO:0000250|UniProtKB:P06797}. |
Modified Residue | |
Post Translational Modification | PTM: During export along the endocytic pathway, pro-CTSL undergoes several proteolytic cleavages to generate the CTSL single-chain and two-chain mature forms, composed of a heavy chain linked to a light chain by disulfide bonds (By similarity). Autocleavage; produces the single-chain CTSL after cleavage of the propeptide. The cleavage can be intermolecular (By similarity). {ECO:0000250|UniProtKB:P06797, ECO:0000250|UniProtKB:P07711}. |
Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000250|UniProtKB:P07154 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 37,383 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |