Detail Information for IndEnz0002006004
IED ID IndEnz0002006004
Enzyme Type ID protease006004
Protein Name Executioner caspase
EC 3.4.22.-
Gene Name ORF73
Organism Spodoptera frugiperda ascovirus 1a (SfAV-1a)
Taxonomic Lineage Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Megaviricetes Pimascovirales Ascoviridae Ascovirus Spodoptera frugiperda ascovirus 1a (SfAV-1a)
Enzyme Sequence MSICYYDTVGREKRLLIINQRALALPNRTISSDGTCCDGDEYLLVDTFTKLNFKVQTIRNASKIVLETTVRNYIEKNVKRVACYFVVVLNDGNDADTILTTDGTYSLSELYALFTLYTVRAIPKVFLIQSCLGAKIDRSHCDRASCQCDQEEDAHPTSVCHDIFVNTVRRVIHACSRKSNGSTTTTETKCSDVATVVLTSPHTEETIIVYLRIEAYLRYGDTKCGCFMIEKFCKNLIKYGTRSSVHTTITMVQNEMQITDPKHVPIVQMNCTKLLFLGDENHIIMEEY
Enzyme Length 288
Uniprot Accession Number Q5K5C1
Absorption
Active Site ACT_SITE 131
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number 3.4.22.-
Enzyme Function FUNCTION: May induce host cell apoptosis and contribute of the establishment of a special cell cleavage process in which apoppotic bodies are rescued by the virus and differentiate to form large vesicles in which virion assembles. {ECO:0000269|PubMed:15933068}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (1); Chain (1)
Keywords Apoptosis;Hydrolase;Protease;Reference proteome;Thiol protease
Interact With
Induction INDUCTION: Synthesized 9 hours after infection of cells ex vivo.
Subcellular Location
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 32,639
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda