| IED ID | IndEnz0002006020 |
| Enzyme Type ID | protease006020 |
| Protein Name |
Decoration protein Capsid protein pb10 |
| Gene Name | N5 T5.151 T5p147 |
| Organism | Escherichia phage T5 (Enterobacteria phage T5) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Demerecviridae Markadamsvirinae Tequintavirus Escherichia phage T5 (Enterobacteria phage T5) |
| Enzyme Sequence | MIDYSGLRTIFGEKLPESHIFFATVAAHKYVPSYAFLRRELGLSSAHTNRKVWKKFVEAYGKAIPPAPPAPPLTLSKDLTASMSVEEGAALTLSVTATGGTGPYTYAWTKDGSPIPDASGATYTKPTAAAEDAGSYKVTVTDSKQVSKDSTTCAVTVNPTVPGG |
| Enzyme Length | 164 |
| Uniprot Accession Number | Q6QGD6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Decoration protein that binds asymmetrically to the center of each capsid protein hexamer after capsid expansion. Stabilizes the capsid and protects from DNA release. {ECO:0000269|PubMed:16876823, ECO:0000269|PubMed:26616586, ECO:0000269|PubMed:28165000}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (9); Chain (1); Domain (1); Helix (7); Region (1); Turn (1) |
| Keywords | 3D-structure;Capsid decoration protein;Capsid protein;Late protein;Reference proteome;Virion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000269|PubMed:16876823, ECO:0000269|PubMed:24198424}. Note=120 copies of the decoration protein are localized on the exterior of the capsid. {ECO:0000269|PubMed:16876823}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (2) |
| Cross Reference PDB | 5LXK; 5LXL; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 17,247 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |