| IED ID | IndEnz0002006069 |
| Enzyme Type ID | protease006069 |
| Protein Name |
Trypsin inhibitor 1 LLDTI-I LLTI-I Trypsin inhibitor I Cleaved into: Trypsin inhibitor 2 LLDTI-II LLTI-II Trypsin inhibitor II |
| Gene Name | |
| Organism | Lagenaria siceraria (Bottle gourd) (Lagenaria leucantha) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Cucurbitales Cucurbitaceae Benincaseae Lagenaria Lagenaria siceraria (Bottle gourd) (Lagenaria leucantha) |
| Enzyme Sequence | QRRCPRIYMECKHDSDCLADCVCLEHGICG |
| Enzyme Length | 30 |
| Uniprot Accession Number | P26771 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Strong inhibitors of trypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Disulfide bond (3); Modified residue (1); Peptide (2); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Knottin;Protease inhibitor;Pyrrolidone carboxylic acid;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 1; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:1562585 |
| Post Translational Modification | PTM: LLTI-III seems to differ from LLDTI-I by the absence of cyclization of Gln-1. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 3,455 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |