IED ID | IndEnz0002006069 |
Enzyme Type ID | protease006069 |
Protein Name |
Trypsin inhibitor 1 LLDTI-I LLTI-I Trypsin inhibitor I Cleaved into: Trypsin inhibitor 2 LLDTI-II LLTI-II Trypsin inhibitor II |
Gene Name | |
Organism | Lagenaria siceraria (Bottle gourd) (Lagenaria leucantha) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Cucurbitales Cucurbitaceae Benincaseae Lagenaria Lagenaria siceraria (Bottle gourd) (Lagenaria leucantha) |
Enzyme Sequence | QRRCPRIYMECKHDSDCLADCVCLEHGICG |
Enzyme Length | 30 |
Uniprot Accession Number | P26771 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Strong inhibitors of trypsin. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Disulfide bond (3); Modified residue (1); Peptide (2); Site (1) |
Keywords | Direct protein sequencing;Disulfide bond;Knottin;Protease inhibitor;Pyrrolidone carboxylic acid;Secreted;Serine protease inhibitor |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | MOD_RES 1; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:1562585 |
Post Translational Modification | PTM: LLTI-III seems to differ from LLDTI-I by the absence of cyclization of Gln-1. |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 3,455 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |