| IED ID | IndEnz0002006109 |
| Enzyme Type ID | protease006109 |
| Protein Name |
Cell shape-determining protein MreC Cell shape protein MreC Rod shape-determining protein MreC |
| Gene Name | mreC BSU28020 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MPNKRLMLLLLCIIILVAMIGFSLKGGRNTTWPEKVIGDTTGVFQNIFHTPAEFFAGIFENINDLKNTYKENERLREKLDGQTQYEAKLQELEEENKSLRDELGHVKSIKDYKPILATVIARSPDNWAKQVTINKGTQQNVAKDMAVTNEKGALIGKIKSSGLNNFTSAVQLLSDTDRNNRVATKISGKKGSKGYGLIEGYDKEKKRLKMTIIERKDKQDVKKGDLIETSGTGGVFPEGLTIGEVTDIESDSYGLTKVAYVKPAADLTDLNNVIVVNRDVPTVDTEEEGS |
| Enzyme Length | 290 |
| Uniprot Accession Number | Q01466 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Involved in formation and maintenance of cell shape. Required for the formation of proper helical filaments of MreB and for cell wall synthesis in the cylindrical part of the cell leading to cell elongation. {ECO:0000269|PubMed:15745453, ECO:0000269|PubMed:16101995}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Coiled coil (1); Mutagenesis (1); Sequence conflict (2); Signal peptide (1) |
| Keywords | Cell membrane;Cell shape;Coiled coil;Membrane;Reference proteome;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:22882210}. Cell septum. Membrane raft {ECO:0000269|PubMed:22882210}. Note=Localizes in helical patterns when associated with the cell membrane (PubMed:15745453). Present in detergent-resistant membrane (DRM) fractions that may be equivalent to eukaryotic membrane rafts; these rafts include proteins involved in signaling, molecule trafficking and protein secretion (PubMed:22882210). {ECO:0000269|PubMed:15745453, ECO:0000269|PubMed:22882210}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 18156271; 18363795; 19192185; 21630458; |
| Motif | |
| Gene Encoded By | |
| Mass | 32,141 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |