| IED ID | IndEnz0002006113 |
| Enzyme Type ID | protease006113 |
| Protein Name |
Bradykinin-potentiating peptide BmKbpp Bpp BmK3 Non-disulfide-bridged peptide 2.2 NDBP-2.2 Non-disulfide-bridged peptide 3.3 NDBP-3.3 |
| Gene Name | |
| Organism | Mesobuthus martensii (Manchurian scorpion) (Buthus martensii) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Scorpiones Buthida Buthoidea Buthidae Mesobuthus Mesobuthus martensii (Manchurian scorpion) (Buthus martensii) |
| Enzyme Sequence | MNKKTLLVIFFVTMLIVDEVNSFRFGSFLKKVWKSKLAKKLRSKGKQLLKDYANKVLNGPEEEAAAPAERRR |
| Enzyme Length | 72 |
| Uniprot Accession Number | Q9Y0X4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Amphipathic peptide that shows bradykinin potentiating activity and antimicrobial activities against bacteria and fungi. Has higher antibacterial activities against Gram-negative than against Gram-positive bacteria. Also inhibits NADPH oxidase-dependent superoxide production (IC(50) is 0.4 uM on granulocytes stimulated with PMA, IC(50) is 0.51 uM on HL-60 cells undifferentiated and IC(50) is 0.53 uM on HL-60 cells treated with DMSO). The C-terminal peptide shows a higher bradykinin potentiating activity than the complete peptide. {ECO:0000269|PubMed:22115565}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Peptide (1); Propeptide (1); Signal peptide (1) |
| Keywords | Antibiotic;Antimicrobial;Cleavage on pair of basic residues;Fungicide;Hypotensive agent;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Secreted;Signal;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,327 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |