| IED ID | IndEnz0002006163 |
| Enzyme Type ID | protease006163 |
| Protein Name |
Cystatin-12 Cystatin TE-1 |
| Gene Name | Cst12 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MLWKSVLPVALIVLGIHDCSFKFIEIDKNEEEFAMSMEHVLFHFNENQNDDFAYKFLRVRRSLRKKYTQKYLVDLEMGRTLCGKYDEDIDNCPLQEGPGEKKVRCTYIVETRVWVTEFTILNSTCVQT |
| Enzyme Length | 128 |
| Uniprot Accession Number | Q8VII2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May play a specialized role in spermatogenesis. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Glycosylation (1); Signal peptide (1) |
| Keywords | Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 15,152 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |