| IED ID | IndEnz0002006179 |
| Enzyme Type ID | protease006179 |
| Protein Name |
Pancreatic secretory trypsin inhibitor Serine protease inhibitor Kazal-type 1 |
| Gene Name | SPINK1 PSTI |
| Organism | Struthio camelus (Common ostrich) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Palaeognathae Struthioniformes (ostriches) Struthionidae Struthio Struthio camelus (Common ostrich) |
| Enzyme Sequence | EPDSAADTGTEAACSNYDLKKGCAKIFDPVCGTDNILYSNECLLCFQNLQRKTNVRIKRRGTCQEPSPR |
| Enzyme Length | 69 |
| Uniprot Accession Number | Q9PSM2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This is a trypsin inhibitor, its physiological function is to prevent the trypsin-catalyzed premature activation of zymogens within the pancreas. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,656 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |