| IED ID | IndEnz0002006182 |
| Enzyme Type ID | protease006182 |
| Protein Name |
Protease inhibitors Cleaved into: Protease inhibitor LCMI-I PARS intercerebralis major peptide D2 PMP-D2 ; Protease inhibitor LCMI-II PARS intercerebralis major peptide C PMP-C |
| Gene Name | |
| Organism | Locusta migratoria (Migratory locust) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Polyneoptera Orthoptera Caelifera (grasshoppers and locusts) Acrididea Acridomorpha Acridoidea Acrididae (short-horned grasshoppers) Oedipodinae (band-winged grasshoppers) Locusta Locusta migratoria (Migratory locust) |
| Enzyme Sequence | MKFALALCAAVLLVVLVQAEEKCTPGQVKQQDCNTCTCTPTGVWGCTRKGCQPAKREISCEPGKTFKDKCNTCRCGADGKSAACTLKACPNQ |
| Enzyme Length | 92 |
| Uniprot Accession Number | P80060 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Both LCMI I and II are inhibitors of chymotrypsin and elastase (in vitro). They both inhibit the prophenol oxidase activation cascade. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Disulfide bond (6); Domain (2); Glycosylation (1); Peptide (2); Signal peptide (1); Site (2) |
| Keywords | 3D-structure;Cleavage on pair of basic residues;Direct protein sequencing;Disulfide bond;Glycoprotein;Protease inhibitor;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence="ECO:0000269|PubMed:1472051, ECO:0000269|PubMed:1740125" |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (2) |
| Cross Reference PDB | 1GL0; 1GL1; 1PMC; |
| Mapped Pubmed ID | 11495915; |
| Motif | |
| Gene Encoded By | |
| Mass | 9,760 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |