| IED ID | IndEnz0002006210 |
| Enzyme Type ID | protease006210 |
| Protein Name |
Cellular tumor antigen p53 Tumor suppressor p53 |
| Gene Name | TP53 |
| Organism | Bos taurus (Bovine) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine) |
| Enzyme Sequence | MEESQAELNVEPPLSQETFSDLWNLLPENNLLSSELSAPVDDLLPYTDVATWLDECPNEAPQMPEPSAPAAPPPATPAPATSWPLSSFVPSQKTYPGNYGFRLGFLQSGTAKSVTCTYSPSLNKLFCQLAKTCPVQLWVDSPPPPGTRVRAMAIYKKLEHMTEVVRRCPHHERSSDYSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYESPEIDSECTTIHYNFMCNSSCMGGMNRRPILTIITLEDSCGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGQSCPEPPPRSTKRALPTNTSSSPQPKKKPLDGEYFTLQIRGFKRYEMFRELNDALELKDALDGREPGESRAHSSHLKSKKRPSPSCHKKPMLKREGPDSD |
| Enzyme Length | 386 |
| Uniprot Accession Number | P67939 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 94..285; /evidence=ECO:0000250 |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Its pro-apoptotic activity is activated via its interaction with PPP1R13B/ASPP1 or TP53BP2/ASPP2 (By similarity). However, this activity is inhibited when the interaction with PPP1R13B/ASPP1 or TP53BP2/ASPP2 is displaced by PPP1R13L/iASPP (By similarity). In cooperation with mitochondrial PPIF is involved in activating oxidative stress-induced necrosis; the function is largely independent of transcription. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression. Induces the transcription of long intergenic non-coding RNA p21 (lincRNA-p21) and lincRNA-Mkln1. LincRNA-p21 participates in TP53-dependent transcriptional repression leading to apoptosis and seems to have an effect on cell-cycle regulation. Regulates the circadian clock by repressing CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER2. {ECO:0000250|UniProtKB:P02340, ECO:0000250|UniProtKB:P04637}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (2); Cross-link (3); DNA binding (1); Metal binding (4); Modified residue (24); Motif (3); Region (16); Sequence conflict (1); Site (1) |
| Keywords | Acetylation;Activator;Apoptosis;Biological rhythms;Cell cycle;Cytoplasm;Cytoskeleton;DNA-binding;Endoplasmic reticulum;Isopeptide bond;Metal-binding;Methylation;Mitochondrion;Necrosis;Nucleus;Phosphoprotein;Reference proteome;Repressor;Transcription;Transcription regulation;Tumor suppressor;Ubl conjugation;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:P04637}. Nucleus {ECO:0000250|UniProtKB:P04637}. Nucleus, PML body {ECO:0000250|UniProtKB:P04637}. Endoplasmic reticulum {ECO:0000250|UniProtKB:P04637}. Mitochondrion matrix {ECO:0000250|UniProtKB:P04637}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000250|UniProtKB:P04637}. Note=Interaction with BANP promotes nuclear localization. Recruited into PML bodies together with CHEK2. Translocates to mitochondria upon oxidative stress. Translocates to mitochondria in response to mitomycin C treatment (By similarity). {ECO:0000250|UniProtKB:P04637}. |
| Modified Residue | MOD_RES 15; /note="Phosphoserine; by CDK5, PRPK, AMPK, NUAK1 and ATM"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 18; /note="Phosphothreonine; by CK1, VRK1 and VRK2"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 20; /note="Phosphoserine; by CHEK2, CK1 and PLK3"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 33; /note="Phosphoserine; by CDK5 and CDK7"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 37; /note="Phosphoserine; by MAPKAPK5"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 112; /note="N6-acetyllysine; by KAT6A"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 175; /note="Phosphoserine; by AURKB"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 262; /note="Phosphoserine; by AURKB"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 277; /note="Phosphothreonine; by AURKB"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 298; /note="N6-acetyllysine"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 308; /note="Phosphoserine; by AURKA, CDK1 and CDK2"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 314; /note="N6-acetyllysine"; /evidence="ECO:0000250|UniProtKB:P02340"; MOD_RES 326; /note="Omega-N-methylarginine"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 330; /note="Symmetric dimethylarginine"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 363; /note="N6,N6-dimethyllysine; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 363; /note="N6-methyllysine; by SMYD2; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 365; /note="N6-methyllysine; by SETD7"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 366; /note="N6,N6-dimethyllysine; by EHMT1 and EHMT2; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 366; /note="N6-acetyllysine; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 374; /note="N6-acetyllysine"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 375; /note="N6,N6-dimethyllysine; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 375; /note="N6-acetyllysine; by KAT6A; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 375; /note="N6-methyllysine; by KMT5A; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 385; /note="Phosphoserine; by CK2, CDK2 and NUAK1"; /evidence="ECO:0000250|UniProtKB:P04637" |
| Post Translational Modification | PTM: Phosphorylation on Ser residues mediates transcriptional activation. Phosphorylated on Thr-18 by VRK1, which may prevent the interaction with MDM2. Phosphorylated on Ser-20 by CHEK2 in response to DNA damage, which prevents ubiquitination by MDM2. Phosphorylated on Ser-20 by PLK3 in response to reactive oxygen species (ROS), promoting p53/TP53-mediated apoptosis. Phosphorylated on Ser-33 by CDK7 in a CAK complex in response to DNA damage. Phosphorylated by HIPK1. Phosphorylated on Ser-385 following UV but not gamma irradiation. Stabilized by CDK5-mediated phosphorylation in response to genotoxic and oxidative stresses at Ser-15 and Ser-33, leading to accumulation of p53/TP53, particularly in the nucleus, thus inducing the transactivation of p53/TP53 target genes. Phosphorylated at Ser-308 and Ser-385 by CDK2 in response to DNA-damage (By similarity). Phosphorylation at Ser-15 is required for interaction with DDX3X and gamma-tubulin (By similarity). {ECO:0000250, ECO:0000250|UniProtKB:P04637}.; PTM: Monomethylated at Lys-365 by SETD7, leading to stabilization and increased transcriptional activation. Monomethylated at Lys-363 by SMYD2, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity. Lys-365 monomethylation prevents interaction with SMYD2 and subsequent monomethylation at Lys-363. Dimethylated at Lys-366 by EHMT1 and EHMT2. Monomethylated at Lys-375 by KMT5A, promoting interaction with L3MBTL1 and leading to repress transcriptional activity. Demethylation of dimethylated Lys-363 by KDM1A prevents interaction with TP53BP1 and represses TP53-mediated transcriptional activation (By similarity). Monomethylated at Arg-326 and dimethylated at Arg-330 by PRMT5; methylation is increased after DNA damage and might possibly affect TP53 target gene specificity (By similarity). {ECO:0000250|UniProtKB:P04637}.; PTM: Sumoylated with SUMO1. Sumoylated at Lys-379 by UBC9 (By similarity). {ECO:0000250}.; PTM: Ubiquitinated by MDM2 and SYVN1, which leads to proteasomal degradation. Ubiquitinated by RFWD3, which works in cooperation with MDM2 and may catalyze the formation of short polyubiquitin chains on p53/TP53 that are not targeted to the proteasome. Ubiquitinated by MKRN1, which leads to proteasomal degradation. Deubiquitinated by USP10, leading to stabilize it. Ubiquitinated by TRIM24, RFFL, RNF34 and RNF125, which leads to proteasomal degradation. Ubiquitination by TOPORS induces degradation. Deubiquitination by USP7, leading to stabilize it. Ubiquitinated by COP1, which leads to proteasomal degradation (By similarity). Ubiquitination and subsequent proteasomal degradation is negatively regulated by CCAR2 (By similarity). Polyubiquitinated by C10orf90/FATS, polyubiquitination is 'Lys-48'-linkage independent and non-proteolytic, leading to TP53 stabilization (By similarity). {ECO:0000250|UniProtKB:P02340, ECO:0000250|UniProtKB:P04637}.; PTM: Acetylated. Acetylation by CREBBP enhances transcriptional activity. Acetylation by EP300. Deacetylation by SIRT1 impairs its ability to induce proapoptotic program and modulate cell senescence. Deacetylation by SIRT2 impairs its ability to induce transcription activation in a AKT-dependent manner. {ECO:0000250|UniProtKB:P04637}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 298..314; /note=Bipartite nuclear localization signal; /evidence=ECO:0000250; MOTIF 332..343; /note=Nuclear export signal; /evidence=ECO:0000250; MOTIF 363..365; /note=[KR]-[STA]-K motif |
| Gene Encoded By | |
| Mass | 43,256 |
| Kinetics | |
| Metal Binding | METAL 168; /note=Zinc; /evidence=ECO:0000250; METAL 171; /note=Zinc; /evidence=ECO:0000250; METAL 231; /note=Zinc; /evidence=ECO:0000250; METAL 235; /note=Zinc; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |