| IED ID | IndEnz0002006295 |
| Enzyme Type ID | protease006295 |
| Protein Name |
Ovomucoid Allergen Gal d I allergen Gal d 1 |
| Gene Name | |
| Organism | Gallus gallus (Chicken) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken) |
| Enzyme Sequence | MAMAGVFVLFSFVLCGFLPDAAFGAEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRAFNPVCGTDGVTYDNECLLCAHKVEQGASVDKRHDGGCRKELAAVSVDCSEYPKPDCTAEDRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC |
| Enzyme Length | 210 |
| Uniprot Accession Number | P01005 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor. Inhibits trypsin. {ECO:0000269|PubMed:23075397}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: No decrease in activity observed after heating for 1 hour at up to 80 degrees Celsius. Retains 20% activity after incubation at 95 degrees Celsius for 1 hour. {ECO:0000269|PubMed:23075397}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: No decrease in activity observed after incubating at pH 2.5 and pH 7.4 for 1 hour. Retains 20% activity after incubation at pH 12 for 1 hour. {ECO:0000269|PubMed:23075397}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (9); Domain (3); Glycosylation (5); Natural variant (1); Sequence conflict (4); Signal peptide (1); Site (3) |
| Keywords | Allergen;Direct protein sequencing;Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000269|PubMed:3548816 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 22,591 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |