| IED ID | IndEnz0002006296 |
| Enzyme Type ID | protease006296 |
| Protein Name |
Serine protease inhibitor Kazal-type 1 Pancreatic secretory trypsin inhibitor |
| Gene Name | SPINK1 PSTI |
| Organism | Ovis aries (Sheep) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Caprinae Ovis Ovis aries (Sheep) |
| Enzyme Sequence | NILGREAKCTNEVNGCPRIYNPVCGTDGVTYANECLLCMENKERQTPVLIQKSGPC |
| Enzyme Length | 56 |
| Uniprot Accession Number | P00997 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens. {ECO:0000250|UniProtKB:P09036}.; FUNCTION: In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. {ECO:0000250|UniProtKB:P09036}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P09036}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,145 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |