Detail Information for IndEnz0002006314
IED ID IndEnz0002006314
Enzyme Type ID protease006314
Protein Name Metalloprotease mig-17
EC 3.4.24.-
Abnormal cell migration protein 17
Gene Name mig-17 F57B7.4
Organism Caenorhabditis elegans
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans
Enzyme Sequence MHTFCILIPTFLVLVWTTESARREKQQSNDISFVKRKVQDGLKFSRVIKYTNETIQGMKTNFNSNKTQELSLDVLVVADFLSYQAFLEMSNGDSHRAIHNLKEYLHALFEQTKIIYDGISFGNETLHMVFAGTWIATQERDCPLWISWAEEEEERVLNEEIRRLEEKERDLNSTFVDDTFFMNSTDSDNSSTDALISSDMPKKLRKFVDITLEEMQENNSTEMTLKIDSKKAIDKFTIWLKEQTGLPRHEHAVLITKFDLISINGNSATQGMAYVGNICENGDSSSVVEDIGAGLTSLIMAHEIGHSLGALHDGAYETAECDSNDNYLMAVAVSGSADRQSFLNSRRMSNCSINSIIENLKEPTANCVKKWKTKKGKDVSQKDFIKKPGELVKITRQCQVAFGPTFIPCLHIGYFHEQSICERIWCSDGESDECQTLNYFPAFDGTECGYNMWCLEGSCVQNTKKWMDCKDINSKTCSKYSTSKLKHYCKSKDFREICCRTCAKKGKIY
Enzyme Length 509
Uniprot Accession Number Q20930
Absorption
Active Site ACT_SITE 303; /evidence=ECO:0000255|PROSITE-ProRule:PRU00276
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number 3.4.24.-
Enzyme Function FUNCTION: Metalloprotease (PubMed:17491590, PubMed:18637819). Acts in the basement membrane to control directional migration of distal tip cells (DTCs) along the body wall basement membranes, a key step that promotes gonad morphogenesis (PubMed:10864868, PubMed:15556863, PubMed:17491590,PubMed:19104038, PubMed:24318535, PubMed:26994289). Regulates DTC migration probably by recruiting fibulin fbl-1, type IV collagen let-2 and nidogen nid-1 to the gonad basement membrane thereby promoting the remodeling of the basement membrane (PubMed:19104038). During larval development and probably upstream of basement membrane proteins fbl-1, let-2 and nid-1, regulates pharynx length, probably by regulating pharyngeal cell length (PubMed:26994289). Does not recruit fbl-1 to the pharynx basement membrane (PubMed:26994289). {ECO:0000269|PubMed:10864868, ECO:0000269|PubMed:15556863, ECO:0000269|PubMed:17491590, ECO:0000269|PubMed:18637819, ECO:0000269|PubMed:19104038, ECO:0000269|PubMed:24318535, ECO:0000269|PubMed:26994289}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (1); Chain (1); Disulfide bond (1); Domain (3); Glycosylation (9); Metal binding (3); Mutagenesis (17); Propeptide (1); Signal peptide (1); Site (1)
Keywords Basement membrane;Cleavage on pair of basic residues;Developmental protein;Disulfide bond;Extracellular matrix;Glycoprotein;Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Repeat;Secreted;Signal;Zinc;Zymogen
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular matrix, basement membrane {ECO:0000269|PubMed:10864868, ECO:0000269|PubMed:17491590, ECO:0000269|PubMed:18637819, ECO:0000269|PubMed:24318535, ECO:0000269|PubMed:26994289}. Note=Secreted as a zymogen (PubMed:17491590, PubMed:18637819). The zymogen localizes to the basement membrane of gonads, intestine and hypodermis (PubMed:17491590, PubMed:18637819). The mature and active form displays a similar localization but only during the L3 larval stage (PubMed:18637819). {ECO:0000269|PubMed:17491590, ECO:0000269|PubMed:18637819}.
Modified Residue
Post Translational Modification PTM: N-glycosylated by the COG complex; required for gonadal localization (PubMed:14688791, PubMed:16354716, PubMed:17761667, PubMed:17491590). N-glycosylation of the propeptide is required for gonadal localization but not for distal tip cell migration (PubMed:17491590). Required for the regulation of pharynx length (PubMed:26994289). N-glycosylation is not required for mig-17 secretion (PubMed:17491590). {ECO:0000269|PubMed:14688791, ECO:0000269|PubMed:16354716, ECO:0000269|PubMed:17491590, ECO:0000269|PubMed:17761667, ECO:0000269|PubMed:26994289}.; PTM: The precursor is cleaved into the active mature form by autoproteolysis (PubMed:17491590, PubMed:18637819). Cleavage occurs after secretion and only during the L3-L4 larval stages (PubMed:18637819). {ECO:0000269|PubMed:17491590, ECO:0000269|PubMed:18637819}.
Signal Peptide SIGNAL 1..20; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 10388818; 17848203; 19098902; 19297413; 21077329; 21177967; 22560298; 23800452; 25298520; 25487147; 33264296;
Motif
Gene Encoded By
Mass 57,976
Kinetics
Metal Binding METAL 302; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU00276; METAL 306; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU00276; METAL 312; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU00276
Rhea ID
Cross Reference Brenda