| IED ID | IndEnz0002006328 |
| Enzyme Type ID | protease006328 |
| Protein Name |
OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 11 OTU domain-containing protein 11 EC 3.4.19.12 Deubiquitinating enzyme OTU11 |
| Gene Name | OTU11 At3g22260 MMP21.4 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MDENHRNPFANASTSARASGSTSASSNSSFSSSVADTDDDQTIARILAEDESLRREGKLGKRLSHLDSIPHTPRVNREIPDINDATLDHELLSGRLATYGLAELQMEGDGNCQFRALADQLFRNADYHKHVRKHVVKQLKQQRKLYEEYVPMKYRHYTRKMKKHGEWGDHVTLQAAADRFEAKICLVTSFRDQSYIEILPHNKNPLREAWLSFWSEVHYNSLYANGVLALPDVPTRKPRRKHWLF |
| Enzyme Length | 245 |
| Uniprot Accession Number | Q0V869 |
| Absorption | |
| Active Site | ACT_SITE 109; /evidence=ECO:0000255; ACT_SITE 112; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q96G74; ACT_SITE 218; /evidence=ECO:0000250|UniProtKB:Q96G74 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:Q96G74}; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation (Probable). Inactive cysteine protease (PubMed:24659992). {ECO:0000269|PubMed:24659992, ECO:0000305|PubMed:24659992}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Alternative sequence (1); Chain (1); Compositional bias (1); Domain (1); Erroneous gene model prediction (1); Region (1); Sequence conflict (1) |
| Keywords | Alternative splicing;Hydrolase;Reference proteome;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14576160; 17317660; 18805951; 21798944; 21838868; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,228 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |